BLASTX nr result
ID: Sinomenium22_contig00028144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028144 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263182.1| PREDICTED: isoleucyl-tRNA synthetase, cytopl... 105 8e-21 ref|XP_006494186.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 104 1e-20 ref|XP_002529754.1| isoleucyl tRNA synthetase, putative [Ricinus... 104 1e-20 ref|XP_007026516.1| TRNA synthetase class I (I, L, M and V) fami... 102 4e-20 emb|CBI36641.3| unnamed protein product [Vitis vinifera] 100 4e-19 ref|XP_004250257.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 98 1e-18 ref|XP_006352369.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 97 2e-18 ref|XP_006352368.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 97 2e-18 ref|XP_003607351.1| Isoleucyl-tRNA synthetase [Medicago truncatu... 97 2e-18 gb|ACJ86280.1| unknown [Medicago truncatula] 97 2e-18 gb|EXB68680.1| Isoleucine--tRNA ligase [Morus notabilis] 93 3e-17 ref|XP_006372913.1| hypothetical protein POPTR_0017s06170g [Popu... 92 7e-17 ref|XP_006372912.1| hypothetical protein POPTR_0017s06170g [Popu... 92 7e-17 ref|XP_004505648.1| PREDICTED: isoleucine--tRNA ligase, cytoplas... 92 1e-16 ref|XP_002874618.1| hypothetical protein ARALYDRAFT_489875 [Arab... 91 1e-16 ref|NP_192770.2| tRNA synthetase class I (I, L, M and V) family ... 91 2e-16 ref|XP_006405304.1| hypothetical protein EUTSA_v10027624mg [Eutr... 90 3e-16 ref|XP_006853902.1| hypothetical protein AMTR_s00036p00173790 [A... 90 4e-16 ref|XP_007225434.1| hypothetical protein PRUPE_ppa000442mg [Prun... 89 8e-16 ref|XP_006299767.1| hypothetical protein CARUB_v10015963mg [Caps... 88 1e-15 >ref|XP_002263182.1| PREDICTED: isoleucyl-tRNA synthetase, cytoplasmic-like [Vitis vinifera] Length = 1183 Score = 105 bits (261), Expect = 8e-21 Identities = 50/70 (71%), Positives = 55/70 (78%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSGN A GLQ YL SRDH NLKSEFQ GN KIKVDC+ +QP DV+LGKH+ LTV Sbjct: 1114 LALYSGNTKFAQGLQAYLFSRDHYNLKSEFQLGNSKIKVDCIENQPAVDVVLGKHVLLTV 1173 Query: 188 GDYYLSTRTE 159 GDYY S +TE Sbjct: 1174 GDYYSSEKTE 1183 >ref|XP_006494186.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Citrus sinensis] Length = 1193 Score = 104 bits (260), Expect = 1e-20 Identities = 48/69 (69%), Positives = 58/69 (84%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSGN GLQ YLLSRDHSNLKSEFQ GNGKI VDC+ +QPP +++LG+H+FL+V Sbjct: 1124 LALYSGNTMFLQGLQMYLLSRDHSNLKSEFQLGNGKIMVDCIENQPPVNLVLGEHVFLSV 1183 Query: 188 GDYYLSTRT 162 GDYY+ T+T Sbjct: 1184 GDYYVRTKT 1192 >ref|XP_002529754.1| isoleucyl tRNA synthetase, putative [Ricinus communis] gi|223530752|gb|EEF32620.1| isoleucyl tRNA synthetase, putative [Ricinus communis] Length = 1175 Score = 104 bits (259), Expect = 1e-20 Identities = 48/69 (69%), Positives = 58/69 (84%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L LY+GN A GL+TYLLSRDHSNL+SEFQ NGKI VDC+ +QP ADV+LG+H+FLTV Sbjct: 1106 LTLYAGNTKFAKGLETYLLSRDHSNLRSEFQQRNGKITVDCIENQPAADVVLGEHLFLTV 1165 Query: 188 GDYYLSTRT 162 GDY+L TR+ Sbjct: 1166 GDYFLRTRS 1174 >ref|XP_007026516.1| TRNA synthetase class I (I, L, M and V) family protein isoform 1 [Theobroma cacao] gi|508715121|gb|EOY07018.1| TRNA synthetase class I (I, L, M and V) family protein isoform 1 [Theobroma cacao] Length = 1184 Score = 102 bits (255), Expect = 4e-20 Identities = 46/68 (67%), Positives = 58/68 (85%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALY+GN A GLQTYLLSRDHS+LKSEFQHG+GK++V C+ +QP +V LG+H+FLTV Sbjct: 1114 LALYAGNTKFAQGLQTYLLSRDHSSLKSEFQHGHGKMEVGCIENQPAVEVTLGEHVFLTV 1173 Query: 188 GDYYLSTR 165 GDYYL+ + Sbjct: 1174 GDYYLTIK 1181 >emb|CBI36641.3| unnamed protein product [Vitis vinifera] Length = 1139 Score = 99.8 bits (247), Expect = 4e-19 Identities = 50/73 (68%), Positives = 55/73 (75%), Gaps = 3/73 (4%) Frame = -2 Query: 368 LALYS---GNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIF 198 LALYS GN A GLQ YL SRDH NLKSEFQ GN KIKVDC+ +QP DV+LGKH+ Sbjct: 1067 LALYSVVAGNTKFAQGLQAYLFSRDHYNLKSEFQLGNSKIKVDCIENQPAVDVVLGKHVL 1126 Query: 197 LTVGDYYLSTRTE 159 LTVGDYY S +TE Sbjct: 1127 LTVGDYYSSEKTE 1139 >ref|XP_004250257.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Solanum lycopersicum] Length = 1182 Score = 98.2 bits (243), Expect = 1e-18 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 365 ALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTVG 186 ALY GN + GL+TYLL RDH NLKSEFQ G GKI V C+ +QPP +V+LGKH+FL+VG Sbjct: 1114 ALYGGNTQYSQGLRTYLLMRDHHNLKSEFQQGKGKITVKCIENQPPVEVILGKHVFLSVG 1173 Query: 185 DYYLSTRTE 159 D++L+T+++ Sbjct: 1174 DHFLNTKSQ 1182 >ref|XP_006352369.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like isoform X2 [Solanum tuberosum] Length = 1003 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/69 (60%), Positives = 54/69 (78%) Frame = -2 Query: 365 ALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTVG 186 ALY GN GLQTYLL RDH NLKSEFQ G GKI V C+ +QPP +V+LGKH+FL+VG Sbjct: 935 ALYGGNTQYCQGLQTYLLMRDHHNLKSEFQQGKGKINVKCIENQPPVEVILGKHVFLSVG 994 Query: 185 DYYLSTRTE 159 D++L+++ + Sbjct: 995 DHFLNSKLQ 1003 >ref|XP_006352368.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like isoform X1 [Solanum tuberosum] Length = 1182 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/69 (60%), Positives = 54/69 (78%) Frame = -2 Query: 365 ALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTVG 186 ALY GN GLQTYLL RDH NLKSEFQ G GKI V C+ +QPP +V+LGKH+FL+VG Sbjct: 1114 ALYGGNTQYCQGLQTYLLMRDHHNLKSEFQQGKGKINVKCIENQPPVEVILGKHVFLSVG 1173 Query: 185 DYYLSTRTE 159 D++L+++ + Sbjct: 1174 DHFLNSKLQ 1182 >ref|XP_003607351.1| Isoleucyl-tRNA synthetase [Medicago truncatula] gi|355508406|gb|AES89548.1| Isoleucyl-tRNA synthetase [Medicago truncatula] Length = 1279 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/69 (63%), Positives = 58/69 (84%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L+L+SG++ A+ LQTYLLSRDHSNLKSEFQ GNGK VD + QP A+V+LG+H+FLTV Sbjct: 1210 LSLFSGDSKFAHNLQTYLLSRDHSNLKSEFQEGNGKKMVDSIEQQPAAEVVLGEHVFLTV 1269 Query: 188 GDYYLSTRT 162 GDYY++ ++ Sbjct: 1270 GDYYVAEKS 1278 >gb|ACJ86280.1| unknown [Medicago truncatula] Length = 306 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/69 (63%), Positives = 58/69 (84%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L+L+SG++ A+ LQTYLLSRDHSNLKSEFQ GNGK VD + QP A+V+LG+H+FLTV Sbjct: 237 LSLFSGDSKFAHNLQTYLLSRDHSNLKSEFQEGNGKKMVDSIEQQPAAEVVLGEHVFLTV 296 Query: 188 GDYYLSTRT 162 GDYY++ ++ Sbjct: 297 GDYYVAEKS 305 >gb|EXB68680.1| Isoleucine--tRNA ligase [Morus notabilis] Length = 1169 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L SGNA + GL+TYLLSRDHSNLKSEFQ+GNGKI VD V + P D++LG+H+FLTV Sbjct: 1098 LCSVSGNAKVSNGLRTYLLSRDHSNLKSEFQNGNGKITVDSVENIPSLDLVLGEHVFLTV 1157 Query: 188 GDYYLSTRT 162 GD+Y +T++ Sbjct: 1158 GDFYSATKS 1166 >ref|XP_006372913.1| hypothetical protein POPTR_0017s06170g [Populus trichocarpa] gi|550319561|gb|ERP50710.1| hypothetical protein POPTR_0017s06170g [Populus trichocarpa] Length = 1162 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/68 (64%), Positives = 53/68 (77%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L+LY GN +GL+TYLLSRDHSNLKSEFQ G+GKI VD V P +V+LG+H+FLTV Sbjct: 1092 LSLYGGNTKSVHGLETYLLSRDHSNLKSEFQLGDGKITVDTVEGLPAVNVVLGEHVFLTV 1151 Query: 188 GDYYLSTR 165 GD LST+ Sbjct: 1152 GDSVLSTK 1159 >ref|XP_006372912.1| hypothetical protein POPTR_0017s06170g [Populus trichocarpa] gi|550319560|gb|ERP50709.1| hypothetical protein POPTR_0017s06170g [Populus trichocarpa] Length = 1154 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/68 (64%), Positives = 53/68 (77%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L+LY GN +GL+TYLLSRDHSNLKSEFQ G+GKI VD V P +V+LG+H+FLTV Sbjct: 1084 LSLYGGNTKSVHGLETYLLSRDHSNLKSEFQLGDGKITVDTVEGLPAVNVVLGEHVFLTV 1143 Query: 188 GDYYLSTR 165 GD LST+ Sbjct: 1144 GDSVLSTK 1151 >ref|XP_004505648.1| PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Cicer arietinum] Length = 1182 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/69 (62%), Positives = 57/69 (82%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L+L+SG++ A LQTYLLSRDHSNLKSEFQ GNGK VD + QP A+V+LG+H+FLTV Sbjct: 1113 LSLFSGDSKFANNLQTYLLSRDHSNLKSEFQDGNGKKIVDEIEQQPAAEVVLGEHVFLTV 1172 Query: 188 GDYYLSTRT 162 GD+Y++ ++ Sbjct: 1173 GDHYVAAKS 1181 >ref|XP_002874618.1| hypothetical protein ARALYDRAFT_489875 [Arabidopsis lyrata subsp. lyrata] gi|297320455|gb|EFH50877.1| hypothetical protein ARALYDRAFT_489875 [Arabidopsis lyrata subsp. lyrata] Length = 1190 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSG+ A GLQTYLLSRDHSNLKSEFQ G+GKI V CV + P V+LG+H+ L+V Sbjct: 1121 LALYSGDVKSATGLQTYLLSRDHSNLKSEFQAGDGKITVSCVENLPSVTVVLGEHLHLSV 1180 Query: 188 GDYYLSTR 165 GD +LS R Sbjct: 1181 GDDFLSKR 1188 >ref|NP_192770.2| tRNA synthetase class I (I, L, M and V) family protein [Arabidopsis thaliana] gi|332657467|gb|AEE82867.1| isoleucyl-tRNA synthetase [Arabidopsis thaliana] Length = 1190 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSG+ A GLQTYLLSRDHSNLKSEFQ G+GKI V C+ + P A V+LG+H+ L+V Sbjct: 1121 LALYSGDVKSATGLQTYLLSRDHSNLKSEFQAGDGKITVSCIENVPVATVVLGEHLHLSV 1180 Query: 188 GDYYLSTR 165 GD LS R Sbjct: 1181 GDDLLSKR 1188 >ref|XP_006405304.1| hypothetical protein EUTSA_v10027624mg [Eutrema salsugineum] gi|557106442|gb|ESQ46757.1| hypothetical protein EUTSA_v10027624mg [Eutrema salsugineum] Length = 1180 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/70 (65%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSG+ A LQTYLLSRDHSNLK+EFQ G+GKI V C+ P V+LG+H+ LTV Sbjct: 1109 LALYSGDVKYARELQTYLLSRDHSNLKTEFQAGDGKITVGCIEKVPVVSVVLGEHLHLTV 1168 Query: 188 GDYY-LSTRT 162 GDYY LSTR+ Sbjct: 1169 GDYYLLSTRS 1178 >ref|XP_006853902.1| hypothetical protein AMTR_s00036p00173790 [Amborella trichopoda] gi|548857570|gb|ERN15369.1| hypothetical protein AMTR_s00036p00173790 [Amborella trichopoda] Length = 1167 Score = 89.7 bits (221), Expect = 4e-16 Identities = 44/70 (62%), Positives = 53/70 (75%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LAL SGN + GL+TYLLSRDH NLKSEF NG +KVDC+ P +++LG+HIFLTV Sbjct: 1098 LALCSGNESHVEGLRTYLLSRDHLNLKSEFHSQNGLLKVDCLEGIPNVELVLGEHIFLTV 1157 Query: 188 GDYYLSTRTE 159 GD YLSTR + Sbjct: 1158 GDCYLSTRRD 1167 >ref|XP_007225434.1| hypothetical protein PRUPE_ppa000442mg [Prunus persica] gi|462422370|gb|EMJ26633.1| hypothetical protein PRUPE_ppa000442mg [Prunus persica] Length = 1182 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 L L SGNA LQTYLLSRDH+ LKSEFQ GNGKI VDC+ + PP D++LG+H+FL+V Sbjct: 1115 LPLCSGNAESVRCLQTYLLSRDHATLKSEFQAGNGKITVDCIENIPPVDLVLGEHVFLSV 1174 Query: 188 GDY 180 GD+ Sbjct: 1175 GDF 1177 >ref|XP_006299767.1| hypothetical protein CARUB_v10015963mg [Capsella rubella] gi|482568476|gb|EOA32665.1| hypothetical protein CARUB_v10015963mg [Capsella rubella] Length = 1180 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/70 (58%), Positives = 52/70 (74%) Frame = -2 Query: 368 LALYSGNANQAYGLQTYLLSRDHSNLKSEFQHGNGKIKVDCVVDQPPADVLLGKHIFLTV 189 LALYSG+ A +Q YLLSRDHS LKSEF+ G+G I V C+ +QPP ++LG+H+ LTV Sbjct: 1101 LALYSGDVKLAMRIQRYLLSRDHSKLKSEFEAGDGMITVSCIENQPPVTLVLGQHLHLTV 1160 Query: 188 GDYYLSTRTE 159 GDYYL + E Sbjct: 1161 GDYYLLEQEE 1170