BLASTX nr result
ID: Sinomenium22_contig00028036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00028036 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007052463.1| F-box family protein with WD40/YVTN repeat d... 61 1e-07 ref|XP_007052462.1| F-box family protein with WD40/YVTN repeat d... 61 1e-07 ref|XP_007052461.1| F-box family protein with WD40/YVTN repeat d... 61 1e-07 emb|CAN61154.1| hypothetical protein VITISV_013775 [Vitis vinifera] 59 7e-07 ref|XP_002271688.2| PREDICTED: F-box/WD-40 repeat-containing pro... 58 1e-06 emb|CBI24978.3| unnamed protein product [Vitis vinifera] 58 1e-06 ref|XP_004303116.1| PREDICTED: F-box/WD-40 repeat-containing pro... 58 2e-06 gb|AFK49436.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_006482933.1| PREDICTED: F-box/WD-40 repeat-containing pro... 57 3e-06 ref|XP_006438944.1| hypothetical protein CICLE_v10031605mg [Citr... 57 3e-06 ref|XP_006438943.1| hypothetical protein CICLE_v10031605mg [Citr... 57 3e-06 ref|XP_006438942.1| hypothetical protein CICLE_v10031605mg [Citr... 57 3e-06 ref|XP_006438941.1| hypothetical protein CICLE_v10031605mg [Citr... 57 3e-06 gb|EXB95302.1| F-box/WD-40 repeat-containing protein [Morus nota... 57 4e-06 ref|XP_004514570.1| PREDICTED: F-box/WD-40 repeat-containing pro... 56 5e-06 >ref|XP_007052463.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 3 [Theobroma cacao] gi|508704724|gb|EOX96620.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 3 [Theobroma cacao] Length = 363 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGLL +R+ IWRR+GKRSIFP+CEGTF++GLCM Sbjct: 105 IVGLLGTRVGIWRRNGKRSIFPSCEGTFSKGLCM 138 >ref|XP_007052462.1| F-box family protein with WD40/YVTN repeat doamin isoform 2 [Theobroma cacao] gi|508704723|gb|EOX96619.1| F-box family protein with WD40/YVTN repeat doamin isoform 2 [Theobroma cacao] Length = 305 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGLL +R+ IWRR+GKRSIFP+CEGTF++GLCM Sbjct: 47 IVGLLGTRVGIWRRNGKRSIFPSCEGTFSKGLCM 80 >ref|XP_007052461.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 1 [Theobroma cacao] gi|508704722|gb|EOX96618.1| F-box family protein with WD40/YVTN repeat doamin, putative isoform 1 [Theobroma cacao] Length = 432 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGLL +R+ IWRR+GKRSIFP+CEGTF++GLCM Sbjct: 174 IVGLLGTRVGIWRRNGKRSIFPSCEGTFSKGLCM 207 >emb|CAN61154.1| hypothetical protein VITISV_013775 [Vitis vinifera] Length = 471 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RIC WRR+GKRSIFP+ EGTF +GLCM Sbjct: 170 IVGLIGTRICXWRRNGKRSIFPSXEGTFMKGLCM 203 >ref|XP_002271688.2| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like [Vitis vinifera] Length = 421 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RIC WRR+GKRSIFP+ EGTF +GLCM Sbjct: 155 IVGLIGTRICTWRRNGKRSIFPSREGTFMKGLCM 188 >emb|CBI24978.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RIC WRR+GKRSIFP+ EGTF +GLCM Sbjct: 170 IVGLIGTRICTWRRNGKRSIFPSREGTFMKGLCM 203 >ref|XP_004303116.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like [Fragaria vesca subsp. vesca] Length = 437 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ SRICIWRR+G RSIFP+ EGTF +GLCM Sbjct: 173 IVGLVGSRICIWRRNGIRSIFPSREGTFPKGLCM 206 >gb|AFK49436.1| unknown [Lotus japonicus] Length = 259 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +R+CIWRR+GKRSIFP+ EG F +GLCM Sbjct: 185 IVGLIGTRLCIWRRNGKRSIFPSNEGKFGKGLCM 218 >ref|XP_006482933.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like isoform X2 [Citrus sinensis] Length = 320 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RICIWRR+G RS+FP+ EGTF +GLCM Sbjct: 56 IVGLIGTRICIWRRNGLRSVFPSREGTFMKGLCM 89 >ref|XP_006438944.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|557541140|gb|ESR52184.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 425 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RICIWRR+G RS+FP+ EGTF +GLCM Sbjct: 161 IVGLIGTRICIWRRNGLRSVFPSREGTFMKGLCM 194 >ref|XP_006438943.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|568858801|ref|XP_006482932.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like isoform X1 [Citrus sinensis] gi|557541139|gb|ESR52183.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 430 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RICIWRR+G RS+FP+ EGTF +GLCM Sbjct: 166 IVGLIGTRICIWRRNGLRSVFPSREGTFMKGLCM 199 >ref|XP_006438942.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|557541138|gb|ESR52182.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 311 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RICIWRR+G RS+FP+ EGTF +GLCM Sbjct: 47 IVGLIGTRICIWRRNGLRSVFPSREGTFMKGLCM 80 >ref|XP_006438941.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] gi|557541137|gb|ESR52181.1| hypothetical protein CICLE_v10031605mg [Citrus clementina] Length = 308 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ +RICIWRR+G RS+FP+ EGTF +GLCM Sbjct: 166 IVGLIGTRICIWRRNGLRSVFPSREGTFMKGLCM 199 >gb|EXB95302.1| F-box/WD-40 repeat-containing protein [Morus notabilis] Length = 424 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGLL +R+CIWRR G +S+FP+ EGTFA+GLCM Sbjct: 166 IVGLLGTRLCIWRRSGTKSMFPSREGTFAKGLCM 199 >ref|XP_004514570.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030-like [Cicer arietinum] Length = 449 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 190 IVGLLVSRICIWRRHGKRSIFPACEGTFARGLCM 291 IVGL+ SR+CIWRR+GKRS+FP+ EG F +G CM Sbjct: 185 IVGLIGSRLCIWRRNGKRSVFPSLEGKFIKGSCM 218