BLASTX nr result
ID: Sinomenium22_contig00027850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027850 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 112 7e-23 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 112 7e-23 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 112 7e-23 gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 111 9e-23 gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus... 110 2e-22 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 3e-22 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 110 3e-22 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 110 3e-22 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 3e-22 ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prun... 110 3e-22 ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 109 5e-22 ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 109 5e-22 ref|XP_002512679.1| fk506-binding protein, putative [Ricinus com... 109 5e-22 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 108 6e-22 tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 108 6e-22 tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 108 6e-22 ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [S... 108 6e-22 ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 108 6e-22 gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK... 108 6e-22 ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Popu... 108 8e-22 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 112 bits (279), Expect = 7e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPENDFNK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 186 RIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 112 bits (279), Expect = 7e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPENDFNK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 185 RIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 241 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 112 bits (279), Expect = 7e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPENDFNK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 201 RIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 257 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPENDFNK GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 137 RIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKILPN 193 >gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] Length = 350 Score = 110 bits (276), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPENDFNK+GP+PTTFSGQRALDFVL+NQGLIDKTLLFDIELLKI+ N Sbjct: 294 RIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLKNQGLIDKTLLFDIELLKIIPN 350 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 110 bits (274), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPE+GYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 211 RIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 110 bits (274), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPE+GYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 194 RIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 110 bits (274), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPE+GYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 211 RIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 110 bits (274), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI+ N Sbjct: 184 RIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELMKIIPN 240 >ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] gi|462422956|gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 110 bits (274), Expect = 3e-22 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIEL+KI+ N Sbjct: 206 RIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKIIPN 262 >ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] gi|508707703|gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 109 bits (272), Expect = 5e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYP NDFNK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 199 RIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 255 >ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] gi|508707702|gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 109 bits (272), Expect = 5e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPPELGYP NDFNK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 193 RIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 249 >ref|XP_002512679.1| fk506-binding protein, putative [Ricinus communis] gi|223548640|gb|EEF50131.1| fk506-binding protein, putative [Ricinus communis] Length = 246 Score = 109 bits (272), Expect = 5e-22 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIM 165 RIIVPPELGYPENDFN++GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ Sbjct: 190 RIIVPPELGYPENDFNRSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIL 244 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Setaria italica] Length = 214 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 157 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 213 >tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 141 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 197 >tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 157 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 213 >ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] gi|241941927|gb|EES15072.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] Length = 207 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 151 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 207 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 183 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 239 >gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 108 bits (271), Expect = 6e-22 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIMSN 171 RIIVPP+LGYP+ND+NK GPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKI+ N Sbjct: 175 RIIVPPDLGYPDNDYNKLGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 231 >ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347126|gb|EEE82687.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 245 Score = 108 bits (270), Expect = 8e-22 Identities = 50/55 (90%), Positives = 55/55 (100%) Frame = +1 Query: 1 RIIVPPELGYPENDFNKAGPKPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIM 165 RIIVPPELGYPEND+NK+GP+PTTFSGQRALDFVLRNQGLIDKTLLFDIELLK++ Sbjct: 189 RIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKVI 243