BLASTX nr result
ID: Sinomenium22_contig00027645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027645 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631844.1| PREDICTED: uncharacterized protein LOC100853... 38 3e-07 emb|CAN75336.1| hypothetical protein VITISV_012698 [Vitis vinifera] 38 4e-07 ref|XP_003616106.1| Nibrin [Medicago truncatula] gi|355517441|gb... 40 4e-07 ref|XP_002322496.2| hypothetical protein POPTR_0015s12710g [Popu... 41 6e-07 ref|XP_007201696.1| hypothetical protein PRUPE_ppa004302mg [Prun... 35 9e-07 >ref|XP_003631844.1| PREDICTED: uncharacterized protein LOC100853048 [Vitis vinifera] gi|296083807|emb|CBI24024.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 38.1 bits (87), Expect(3) = 3e-07 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -3 Query: 98 REYDYGSCEEAEHVNEEKKRKQIEAFAMDLFD 3 +E D GS E + V EEKKRKQ+EA A DLF+ Sbjct: 543 KESDNGSDEVMQSVKEEKKRKQMEAIAEDLFN 574 Score = 33.5 bits (75), Expect(3) = 3e-07 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -1 Query: 268 DIIYSQDWIVMDTNTIASVNSLGIKFVANFKSFKK 164 D++YSQD IV D N + S +S + V NFK F+K Sbjct: 489 DVLYSQDLIVRDINLLTSFSSTKNRIV-NFKCFRK 522 Score = 27.3 bits (59), Expect(3) = 3e-07 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 168 RRKIKIGNSSKDLIPFLRQPYK 103 + K + GNS +LIPF + PYK Sbjct: 522 KAKTQSGNSFNNLIPFAKYPYK 543 >emb|CAN75336.1| hypothetical protein VITISV_012698 [Vitis vinifera] Length = 280 Score = 38.1 bits (87), Expect(3) = 4e-07 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -3 Query: 98 REYDYGSCEEAEHVNEEKKRKQIEAFAMDLFD 3 +E D GS E + V EEKKRKQ+EA A DLF+ Sbjct: 228 KESDNGSDEVMQSVKEEKKRKQMEAIAEDLFN 259 Score = 33.5 bits (75), Expect(3) = 4e-07 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -1 Query: 268 DIIYSQDWIVMDTNTIASVNSLGIKFVANFKSFKK 164 D++YSQD IV D N + S +S + V NFK F+K Sbjct: 174 DVLYSQDLIVRDINLLTSFSSTKNRIV-NFKCFRK 207 Score = 27.3 bits (59), Expect(3) = 4e-07 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 168 RRKIKIGNSSKDLIPFLRQPYK 103 + K + GNS +LIPF + PYK Sbjct: 207 KAKTQSGNSFNNLIPFAKYPYK 228 >ref|XP_003616106.1| Nibrin [Medicago truncatula] gi|355517441|gb|AES99064.1| Nibrin [Medicago truncatula] Length = 571 Score = 40.0 bits (92), Expect(3) = 4e-07 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -3 Query: 98 REYDYGSCEEAEHVNEEKKRKQIEAFAMDLFD 3 ++ DYG E AE+V EEK+RKQ EA A DLF+ Sbjct: 521 KDSDYGKDETAEYVKEEKRRKQREAVADDLFN 552 Score = 33.1 bits (74), Expect(3) = 4e-07 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -1 Query: 268 DIIYSQDWIVMDTNTIASVNSLGIKFVANFKSFKK 164 D+IYSQ+ IV D N + + +S V NFK F+K Sbjct: 466 DVIYSQNLIVRDINKLTNRSSAPNSSVPNFKRFRK 500 Score = 25.4 bits (54), Expect(3) = 4e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 150 GNSSKDLIPFLRQPYK 103 GNS +L+PF + PYK Sbjct: 506 GNSFSNLVPFAKYPYK 521 >ref|XP_002322496.2| hypothetical protein POPTR_0015s12710g [Populus trichocarpa] gi|550322593|gb|EEF06623.2| hypothetical protein POPTR_0015s12710g [Populus trichocarpa] Length = 517 Score = 41.2 bits (95), Expect(2) = 6e-07 Identities = 22/60 (36%), Positives = 37/60 (61%) Frame = -3 Query: 182 F*KLQEGKLRLVTAPKILFPF*DNRTSRREYDYGSCEEAEHVNEEKKRKQIEAFAMDLFD 3 F + ++G + + L PF ++ +++DYG+ + E V EEK+RKQ+EA A DLF+ Sbjct: 440 FKRFRKGNTQSGNSFNNLIPF--SKYPYKDFDYGNQDMLESVKEEKRRKQMEAIAEDLFN 497 Score = 37.7 bits (86), Expect(2) = 6e-07 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = -1 Query: 268 DIIYSQDWIVMDTNTIASVNSLGIKFVANFKSFKKEN 158 DIIYSQD I+ D N A ++S V NFK F+K N Sbjct: 411 DIIYSQDLIIRDLNLPAQISSTPNNEVLNFKRFRKGN 447 >ref|XP_007201696.1| hypothetical protein PRUPE_ppa004302mg [Prunus persica] gi|462397096|gb|EMJ02895.1| hypothetical protein PRUPE_ppa004302mg [Prunus persica] Length = 517 Score = 35.4 bits (80), Expect(3) = 9e-07 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -3 Query: 98 REYDYGSCEEAEHVNEEKKRKQIEAFAMDLFD 3 ++ DYG E E V EEK+RKQ+EA + +LF+ Sbjct: 466 KDSDYGGEEVLESVKEEKRRKQMEAVSEELFN 497 Score = 33.9 bits (76), Expect(3) = 9e-07 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = -1 Query: 268 DIIYSQDWIVMDTNTIASVNSLGIKFVANFKSFKKEN 158 DIIYSQD IV D + +V + V NFK F+K N Sbjct: 411 DIIYSQDLIVRDASIPYTVATTANHRVVNFKRFRKPN 447 Score = 28.1 bits (61), Expect(3) = 9e-07 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 159 IKIGNSSKDLIPFLRQPYK 103 I+ GNS ++IPFL+ PYK Sbjct: 448 IQSGNSFNNIIPFLKYPYK 466