BLASTX nr result
ID: Sinomenium22_contig00027574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027574 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006453353.1| hypothetical protein CICLE_v10009532mg [Citr... 67 3e-09 ref|XP_006453352.1| hypothetical protein CICLE_v10009532mg [Citr... 67 3e-09 ref|XP_004243079.1| PREDICTED: ribulose bisphosphate carboxylase... 66 4e-09 ref|XP_006344531.1| PREDICTED: ribulose bisphosphate carboxylase... 65 8e-09 ref|XP_002531030.1| ribulose-bisphosphate carboxylase, putative ... 65 8e-09 ref|XP_004954709.1| PREDICTED: ribulose bisphosphate carboxylase... 64 2e-08 ref|XP_004296442.1| PREDICTED: ribulose bisphosphate carboxylase... 64 2e-08 ref|XP_006856657.1| hypothetical protein AMTR_s00054p00039660 [A... 64 2e-08 gb|AAL56980.1| ribulose 1,5-bisphosphate carboxylase small subun... 64 2e-08 ref|XP_006646894.1| PREDICTED: ribulose bisphosphate carboxylase... 64 3e-08 ref|NP_001045917.1| Os02g0152400 [Oryza sativa Japonica Group] g... 64 3e-08 gb|EYU37322.1| hypothetical protein MIMGU_mgv1a015027mg [Mimulus... 63 4e-08 gb|ADW80768.1| chloroplast ribulose-1,5-bisphosphate carboxylase... 63 5e-08 gb|EXB55399.1| hypothetical protein L484_016767 [Morus notabilis] 62 8e-08 ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase... 61 1e-07 emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subu... 61 1e-07 gb|ABN41481.1| putative chloroplast ribulose-1,5-bisphosphate ca... 61 1e-07 gb|ABK55670.1| chloroplast ribulose-1,5-bisphosphate carboxylase... 61 1e-07 sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carbox... 61 2e-07 ref|XP_004962611.1| PREDICTED: ribulose bisphosphate carboxylase... 61 2e-07 >ref|XP_006453353.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] gi|567922696|ref|XP_006453354.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] gi|557556579|gb|ESR66593.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] gi|557556580|gb|ESR66594.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] Length = 172 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYVHR NSRMPGYYDGRYWT+WKLPMF Sbjct: 93 EVGYVHRENSRMPGYYDGRYWTMWKLPMF 121 >ref|XP_006453352.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] gi|568840482|ref|XP_006474196.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Citrus sinensis] gi|557556578|gb|ESR66592.1| hypothetical protein CICLE_v10009532mg [Citrus clementina] Length = 201 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYVHR NSRMPGYYDGRYWT+WKLPMF Sbjct: 122 EVGYVHRENSRMPGYYDGRYWTMWKLPMF 150 >ref|XP_004243079.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Solanum lycopersicum] Length = 169 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYVHR NS+MPGYYDGRYWTLWKLPMF Sbjct: 94 QVGYVHRENSKMPGYYDGRYWTLWKLPMF 122 >ref|XP_006344531.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Solanum tuberosum] Length = 169 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYVHR NS MPGYYDGRYWTLWKLPMF Sbjct: 94 QVGYVHRENSNMPGYYDGRYWTLWKLPMF 122 >ref|XP_002531030.1| ribulose-bisphosphate carboxylase, putative [Ricinus communis] gi|223529383|gb|EEF31347.1| ribulose-bisphosphate carboxylase, putative [Ricinus communis] Length = 94 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 83 GYVHRTNSRMPGYYDGRYWTLWKLPMF 3 GYVHR NSRMPGYYDGRYWTLWKLPMF Sbjct: 18 GYVHRENSRMPGYYDGRYWTLWKLPMF 44 >ref|XP_004954709.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Setaria italica] Length = 185 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 K G +HR+NSRMPGYYDGRYWTLWKLPMF Sbjct: 98 KAGEIHRSNSRMPGYYDGRYWTLWKLPMF 126 >ref|XP_004296442.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 190 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYV R NSRMPGYYDGRYWTLWKLPMF Sbjct: 109 EVGYVQRENSRMPGYYDGRYWTLWKLPMF 137 >ref|XP_006856657.1| hypothetical protein AMTR_s00054p00039660 [Amborella trichopoda] gi|548860557|gb|ERN18124.1| hypothetical protein AMTR_s00054p00039660 [Amborella trichopoda] Length = 169 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 +VGYV R NSRMPGYYDGRYWTLWKLPMF Sbjct: 93 EVGYVSRQNSRMPGYYDGRYWTLWKLPMF 121 >gb|AAL56980.1| ribulose 1,5-bisphosphate carboxylase small subunit [Larrea tridentata] Length = 107 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 C+ F ++ G+V+R SRMPGYYDGRYWT+WKLPMF Sbjct: 42 CLEFSIESGFVYRETSRMPGYYDGRYWTMWKLPMF 76 >ref|XP_006646894.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Oryza brachyantha] Length = 181 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 K G +HR+NSRMPGYYDGRYWTLWKLPMF Sbjct: 99 KEGKIHRSNSRMPGYYDGRYWTLWKLPMF 127 >ref|NP_001045917.1| Os02g0152400 [Oryza sativa Japonica Group] gi|51535337|dbj|BAD38596.1| putative ribulose 1,5-bisphosphate carboxylase small subunit [Oryza sativa Japonica Group] gi|51535980|dbj|BAD38061.1| putative ribulose 1,5-bisphosphate carboxylase small subunit [Oryza sativa Japonica Group] gi|113535448|dbj|BAF07831.1| Os02g0152400 [Oryza sativa Japonica Group] gi|218190079|gb|EEC72506.1| hypothetical protein OsI_05882 [Oryza sativa Indica Group] gi|222622186|gb|EEE56318.1| hypothetical protein OsJ_05407 [Oryza sativa Japonica Group] Length = 183 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 K G +HR+NSRMPGYYDGRYWTLWKLPMF Sbjct: 96 KEGEIHRSNSRMPGYYDGRYWTLWKLPMF 124 >gb|EYU37322.1| hypothetical protein MIMGU_mgv1a015027mg [Mimulus guttatus] Length = 170 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 K+GYV+R NSRMP YYDGRYWTLWKLPMF Sbjct: 93 KLGYVYRENSRMPNYYDGRYWTLWKLPMF 121 >gb|ADW80768.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Flaveria floridana] Length = 97 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 C+ F ++ G+VHR N+R PGYYDGRYWT+WKLPMF Sbjct: 39 CLEFELEHGFVHRENARSPGYYDGRYWTMWKLPMF 73 >gb|EXB55399.1| hypothetical protein L484_016767 [Morus notabilis] Length = 176 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 83 GYVHRTNSRMPGYYDGRYWTLWKLPMF 3 G+VHR NSR+PGYYDGRYWTLWKLPMF Sbjct: 96 GHVHRENSRIPGYYDGRYWTLWKLPMF 122 >ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Cucumis sativus] gi|449512849|ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Cucumis sativus] Length = 185 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 CV F + G+V+R N R PGYYDGRYWT+WKLPMF Sbjct: 100 CVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMF 134 >emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis sativus] Length = 185 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 CV F + G+V+R N R PGYYDGRYWT+WKLPMF Sbjct: 100 CVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMF 134 >gb|ABN41481.1| putative chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Cucumis sativus] Length = 93 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 CV F + G+V+R N R PGYYDGRYWT+WKLPMF Sbjct: 4 CVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMF 38 >gb|ABK55670.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Cucumis sativus] Length = 125 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 CV F + G+V+R N R PGYYDGRYWT+WKLPMF Sbjct: 91 CVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMF 125 >sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, chloroplastic; Short=RuBisCO small subunit; Flags: Precursor gi|218021|dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta] Length = 183 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -1 Query: 107 CVFFCVKVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 C+ F ++ G+V+R N R PGYYDGRYWT+WKLPMF Sbjct: 101 CLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMF 135 >ref|XP_004962611.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like [Setaria italica] Length = 173 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -1 Query: 89 KVGYVHRTNSRMPGYYDGRYWTLWKLPMF 3 KVG+V+R N+R PGYYDGRYWT+WKLPMF Sbjct: 90 KVGFVYRENNRSPGYYDGRYWTMWKLPMF 118