BLASTX nr result
ID: Sinomenium22_contig00027561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027561 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHG98058.1| isopentenyl diphosphate isomerase, partial [Plect... 57 3e-06 gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus... 55 8e-06 gb|ABW98669.1| plastid isopentenyl pyrophosphate:dimethylallyl p... 55 8e-06 >gb|AHG98058.1| isopentenyl diphosphate isomerase, partial [Plectranthus barbatus] Length = 244 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 269 ATMGEVLTDSAMDAVQKRLMFEDECILVDEN 361 +TMG+V DSAMDAVQ+RLMFEDECILVDEN Sbjct: 8 STMGDVTADSAMDAVQRRLMFEDECILVDEN 38 >gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus guttatus] Length = 301 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 269 ATMGEVLTDSAMDAVQKRLMFEDECILVDEN 361 +TMG+ DSAMDAVQ+RLMFEDECILVDEN Sbjct: 65 STMGDAAADSAMDAVQRRLMFEDECILVDEN 95 >gb|ABW98669.1| plastid isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase isoform 1 [Catharanthus roseus] Length = 311 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 269 ATMGEVLTDSAMDAVQKRLMFEDECILVDEN 361 ++MG +TDSAMDAVQ+RLMFEDECILVDEN Sbjct: 75 SSMGAAVTDSAMDAVQRRLMFEDECILVDEN 105