BLASTX nr result
ID: Sinomenium22_contig00027235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027235 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFX72882.1| MADS-box protein AGL15 [Aquilegia coerulea] 66 4e-09 >gb|AFX72882.1| MADS-box protein AGL15 [Aquilegia coerulea] Length = 278 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +3 Query: 9 SQKKHDMINS-DLSCRYTSERQGESDTSLHLGLSSEAYLPRKASARASSSNDSGTDMASR 185 S KHD+I+S + C E+ GESDTSLHLGLSSE + RKA RAS SNDSGT+ + R Sbjct: 219 SHTKHDVISSSNAGCNCIVEKPGESDTSLHLGLSSEVHRKRKAPERASCSNDSGTETSGR 278