BLASTX nr result
ID: Sinomenium22_contig00027145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027145 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910... 69 1e-09 ref|XP_007045152.1| O-fucosyltransferase family protein [Theobro... 68 2e-09 ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910... 68 2e-09 ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein ... 67 3e-09 ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910... 67 5e-09 ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910... 65 1e-08 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis] 65 1e-08 ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Popu... 65 1e-08 ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prun... 64 2e-08 ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910... 64 2e-08 ref|XP_003529417.1| PREDICTED: uncharacterized protein At1g04910... 64 4e-08 ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phas... 63 5e-08 gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlise... 63 5e-08 ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910... 62 9e-08 ref|XP_004498293.1| PREDICTED: uncharacterized protein At1g04910... 62 9e-08 ref|XP_004150597.1| PREDICTED: DUF246 domain-containing protein ... 62 9e-08 ref|XP_002311505.2| hypothetical protein POPTR_0008s12960g [Popu... 62 1e-07 ref|XP_002526030.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [A... 61 2e-07 ref|XP_004963730.1| PREDICTED: uncharacterized protein At1g04910... 60 4e-07 >ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca subsp. vesca] Length = 569 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSL 478 DSKG E+KRPND+IYTFPCPDCMCR +KSED++ SL Sbjct: 532 DSKGFELKRPNDSIYTFPCPDCMCRTNKSEDSKLSL 567 >ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao] gi|508709087|gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao] Length = 561 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG E+KRPND+IYTFPCPDCMCR +KSED+++S Sbjct: 524 DSKGFELKRPNDSIYTFPCPDCMCRTNKSEDSRSS 558 >ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum] Length = 581 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSLV 475 DSKGIEIKRPND+IYTFPCPDCMCR +++ED+++S V Sbjct: 544 DSKGIEIKRPNDSIYTFPCPDCMCRSNRTEDSKSSSV 580 >ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297737694|emb|CBI26895.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 67.4 bits (163), Expect = 3e-09 Identities = 26/35 (74%), Positives = 34/35 (97%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 D+KG E+KRPND+IYTFPCPDCMCR++KSED+++S Sbjct: 524 DAKGFELKRPNDSIYTFPCPDCMCRMNKSEDSRSS 558 >ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Solanum tuberosum] Length = 578 Score = 66.6 bits (161), Expect = 5e-09 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSLV 475 DSKGIEIKRPND+IY+FPCPDCMCR +++ED+++S V Sbjct: 541 DSKGIEIKRPNDSIYSFPCPDCMCRSNRTEDSRSSSV 577 >ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum] Length = 560 Score = 65.5 bits (158), Expect = 1e-08 Identities = 24/35 (68%), Positives = 34/35 (97%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG+E+KRPND+IY+FPCPDCMCR +K++D+++S Sbjct: 523 DSKGVELKRPNDSIYSFPCPDCMCRANKTDDSKSS 557 >gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis] Length = 562 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 D KG E+KRPND+IYTFPCPDCMCR++K+ED++ S Sbjct: 525 DLKGFELKRPNDSIYTFPCPDCMCRINKTEDSKPS 559 >ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa] gi|222864919|gb|EEF02050.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa] Length = 569 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/37 (64%), Positives = 35/37 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSLV 475 DSKG E+KRPND++Y++PCPDCMCRV+++ED+++S V Sbjct: 532 DSKGFELKRPNDSVYSYPCPDCMCRVNRTEDSRSSSV 568 >ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica] gi|462422665|gb|EMJ26928.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica] Length = 561 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQ 487 DSKG E+KRPND+IYTFPCPDCMCR +K+ED++ Sbjct: 524 DSKGFELKRPNDSIYTFPCPDCMCRSNKTEDSR 556 >ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Glycine max] gi|571563558|ref|XP_006605495.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Glycine max] Length = 564 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/35 (65%), Positives = 34/35 (97%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG+E+KRPND+IY+FPCPDCMCR ++++D+++S Sbjct: 527 DSKGVELKRPNDSIYSFPCPDCMCRANRTDDSRSS 561 >ref|XP_003529417.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max] Length = 564 Score = 63.5 bits (153), Expect = 4e-08 Identities = 24/36 (66%), Positives = 34/36 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSL 478 DSKG+E+KRPND+IY+FPCPDCMCR ++++D ++SL Sbjct: 527 DSKGVELKRPNDSIYSFPCPDCMCRSNRTDDLRSSL 562 >ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris] gi|561031167|gb|ESW29746.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris] Length = 563 Score = 63.2 bits (152), Expect = 5e-08 Identities = 22/35 (62%), Positives = 34/35 (97%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG+E+KRPND+IY+FPCPDCMCR ++++D++++ Sbjct: 526 DSKGVELKRPNDSIYSFPCPDCMCRANRTDDSRSA 560 >gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlisea aurea] Length = 174 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKGIE+KRPND+IY+ PCPDCMCRV+ +ED+++S Sbjct: 137 DSKGIELKRPNDSIYSVPCPDCMCRVNGTEDSKSS 171 >ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Cicer arietinum] Length = 519 Score = 62.4 bits (150), Expect = 9e-08 Identities = 22/35 (62%), Positives = 33/35 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG+E+KRPND+IY+FPCPDCMC ++++D+++S Sbjct: 482 DSKGVELKRPNDSIYSFPCPDCMCHANRTDDSKSS 516 >ref|XP_004498293.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Cicer arietinum] Length = 563 Score = 62.4 bits (150), Expect = 9e-08 Identities = 22/35 (62%), Positives = 33/35 (94%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG+E+KRPND+IY+FPCPDCMC ++++D+++S Sbjct: 526 DSKGVELKRPNDSIYSFPCPDCMCHANRTDDSKSS 560 >ref|XP_004150597.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449514634|ref|XP_004164435.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 563 Score = 62.4 bits (150), Expect = 9e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTSL 478 DSKG E+KRP+D+IYTFPCPDCMC +KS D ++SL Sbjct: 526 DSKGFELKRPSDSIYTFPCPDCMCFTNKSNDTKSSL 561 >ref|XP_002311505.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa] gi|550332954|gb|EEE88872.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa] Length = 569 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG EIKRPND+IY+FPCPDCMC V+++E +++S Sbjct: 532 DSKGFEIKRPNDSIYSFPCPDCMCHVNRTEGSRSS 566 >ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis] gi|223534677|gb|EEF36370.1| conserved hypothetical protein [Ricinus communis] Length = 570 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQTS 481 DSKG E+KRPND+IY+FPCPDCMCR++K+E ++ Sbjct: 535 DSKGFELKRPNDSIYSFPCPDCMCRMNKTESRSSA 569 >ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda] gi|548831278|gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda] Length = 554 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQ 487 D+KG+EI+RPND+IYTFPCPDCMCR + +D+Q Sbjct: 517 DAKGMEIRRPNDSIYTFPCPDCMCRANNLDDSQ 549 >ref|XP_004963730.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica] Length = 576 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/33 (66%), Positives = 32/33 (96%) Frame = -3 Query: 585 DSKGIEIKRPNDAIYTFPCPDCMCRVSKSEDNQ 487 D+KGIE+KRPN++IYTFPCPDCMCR++++E ++ Sbjct: 539 DTKGIEMKRPNESIYTFPCPDCMCRLNRTEHSK 571