BLASTX nr result
ID: Sinomenium22_contig00027117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027117 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268013.1| PREDICTED: acetylornithine aminotransferase,... 63 4e-08 >ref|XP_002268013.1| PREDICTED: acetylornithine aminotransferase, mitochondrial [Vitis vinifera] gi|296082676|emb|CBI21681.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = +1 Query: 313 GKSLVRVDCGRRISACLNLEVEAPASLSSEKLGFGDAKEVMEMEAKVLVG 462 G++LV+V+ R +SACLN+EV+AP S + KLGFG++K+VMEME +V+VG Sbjct: 27 GRTLVQVNGQRAVSACLNVEVKAPKSANLGKLGFGESKDVMEMEGRVIVG 76