BLASTX nr result
ID: Sinomenium22_contig00027092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027092 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467518.1| PREDICTED: CAS1 domain-containing protein 1-... 69 9e-10 ref|XP_006449635.1| hypothetical protein CICLE_v10014824mg [Citr... 67 3e-09 ref|NP_001031479.2| protein REDUCED WALL ACETYLATION 3 [Arabidop... 67 3e-09 ref|NP_180988.3| protein REDUCED WALL ACETYLATION 3 [Arabidopsis... 67 3e-09 ref|XP_006293944.1| hypothetical protein CARUB_v10022936mg [Caps... 67 4e-09 ref|XP_002519732.1| O-acetyltransferase, putative [Ricinus commu... 66 5e-09 ref|XP_006410586.1| hypothetical protein EUTSA_v10016486mg [Eutr... 66 6e-09 ref|XP_002879497.1| O-acetyltransferase family protein [Arabidop... 66 6e-09 ref|XP_004234055.1| PREDICTED: CAS1 domain-containing protein 1-... 64 2e-08 ref|XP_004234054.1| PREDICTED: CAS1 domain-containing protein 1-... 64 2e-08 ref|XP_004504706.1| PREDICTED: CAS1 domain-containing protein 1-... 64 2e-08 ref|XP_004504705.1| PREDICTED: CAS1 domain-containing protein 1-... 64 2e-08 gb|ACJ85538.1| unknown [Medicago truncatula] gi|388497864|gb|AFK... 64 2e-08 ref|XP_004155531.1| PREDICTED: LOW QUALITY PROTEIN: CAS1 domain-... 64 3e-08 ref|XP_004134577.1| PREDICTED: CAS1 domain-containing protein 1-... 64 3e-08 ref|XP_007158969.1| hypothetical protein PHAVU_002G197200g [Phas... 62 7e-08 ref|XP_006356085.1| PREDICTED: CAS1 domain-containing protein 1-... 62 1e-07 ref|XP_006356084.1| PREDICTED: CAS1 domain-containing protein 1-... 62 1e-07 ref|XP_007025164.1| O-acetyltransferase family protein isoform 5... 61 2e-07 ref|XP_007025163.1| O-acetyltransferase family protein isoform 4... 61 2e-07 >ref|XP_006467518.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Citrus sinensis] gi|568826316|ref|XP_006467519.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Citrus sinensis] Length = 543 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LT++LKSVFVPTKDNRRLLCN + ISLCLY +SLI LQIP Sbjct: 497 LTSTLKSVFVPTKDNRRLLCNFLAAVAISLCLYCVSLILLQIP 539 >ref|XP_006449635.1| hypothetical protein CICLE_v10014824mg [Citrus clementina] gi|557552246|gb|ESR62875.1| hypothetical protein CICLE_v10014824mg [Citrus clementina] Length = 543 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LT++LKSVFVPTKDN+RLLCN + ISLCLY +SLI LQIP Sbjct: 497 LTSTLKSVFVPTKDNQRLLCNFLAAVAISLCLYCVSLILLQIP 539 >ref|NP_001031479.2| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] gi|330253877|gb|AEC08971.1| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] Length = 527 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVF+PTKD++RLL NV+ GA IS CLYL SLI LQIP Sbjct: 484 LTNTLKSVFIPTKDDKRLLHNVLAGAAISFCLYLTSLILLQIP 526 >ref|NP_180988.3| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] gi|79324285|ref|NP_001031478.1| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] gi|51536464|gb|AAU05470.1| At2g34410 [Arabidopsis thaliana] gi|55733775|gb|AAV59284.1| At2g34410 [Arabidopsis thaliana] gi|62320442|dbj|BAD94920.1| hypothetical protein [Arabidopsis thaliana] gi|110737554|dbj|BAF00719.1| hypothetical protein [Arabidopsis thaliana] gi|222423437|dbj|BAH19689.1| AT2G34410 [Arabidopsis thaliana] gi|330253875|gb|AEC08969.1| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] gi|330253876|gb|AEC08970.1| protein REDUCED WALL ACETYLATION 3 [Arabidopsis thaliana] Length = 540 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVF+PTKD++RLL NV+ GA IS CLYL SLI LQIP Sbjct: 497 LTNTLKSVFIPTKDDKRLLHNVLAGAAISFCLYLTSLILLQIP 539 >ref|XP_006293944.1| hypothetical protein CARUB_v10022936mg [Capsella rubella] gi|482562652|gb|EOA26842.1| hypothetical protein CARUB_v10022936mg [Capsella rubella] Length = 549 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVF+PTKD++RLL NV+ GA IS CLYL +LI LQIP Sbjct: 506 LTNTLKSVFIPTKDDKRLLHNVIAGAAISFCLYLTALILLQIP 548 >ref|XP_002519732.1| O-acetyltransferase, putative [Ricinus communis] gi|223541149|gb|EEF42705.1| O-acetyltransferase, putative [Ricinus communis] Length = 578 Score = 66.2 bits (160), Expect = 5e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK+VF+PTKDNRRL N V GATISL LY +SLI LQIP Sbjct: 497 LTNTLKTVFIPTKDNRRLFYNFVAGATISLFLYFVSLILLQIP 539 >ref|XP_006410586.1| hypothetical protein EUTSA_v10016486mg [Eutrema salsugineum] gi|557111755|gb|ESQ52039.1| hypothetical protein EUTSA_v10016486mg [Eutrema salsugineum] Length = 540 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVF+PTKD++RLL NV+ GA IS CLYL +LI LQIP Sbjct: 497 LTNTLKSVFIPTKDDKRLLHNVLAGAAISFCLYLTALILLQIP 539 >ref|XP_002879497.1| O-acetyltransferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297325336|gb|EFH55756.1| O-acetyltransferase family protein [Arabidopsis lyrata subsp. lyrata] Length = 540 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVF+PTKD++RLL NV+ GA IS CLYL +LI LQIP Sbjct: 497 LTNTLKSVFIPTKDDKRLLHNVLAGAAISFCLYLTALILLQIP 539 >ref|XP_004234055.1| PREDICTED: CAS1 domain-containing protein 1-like isoform 2 [Solanum lycopersicum] Length = 541 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVFVPT+DN++LL N + G ISLCLY+IS I +QIP Sbjct: 498 LTNTLKSVFVPTRDNQKLLHNFIAGVAISLCLYIISFILIQIP 540 >ref|XP_004234054.1| PREDICTED: CAS1 domain-containing protein 1-like isoform 1 [Solanum lycopersicum] Length = 562 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVFVPT+DN++LL N + G ISLCLY+IS I +QIP Sbjct: 519 LTNTLKSVFVPTRDNQKLLHNFIAGVAISLCLYIISFILIQIP 561 >ref|XP_004504706.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Cicer arietinum] Length = 543 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK+VFVPTKDNRRLL N +TG IS+ LY ++LI LQIP Sbjct: 497 LTNTLKTVFVPTKDNRRLLHNFITGVAISISLYCVALILLQIP 539 >ref|XP_004504705.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Cicer arietinum] Length = 559 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK+VFVPTKDNRRLL N +TG IS+ LY ++LI LQIP Sbjct: 497 LTNTLKTVFVPTKDNRRLLHNFITGVAISISLYCVALILLQIP 539 >gb|ACJ85538.1| unknown [Medicago truncatula] gi|388497864|gb|AFK36998.1| unknown [Medicago truncatula] Length = 309 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK+VFVPTKDNRRLL N +TG IS+ LY I+LI LQIP Sbjct: 263 LTNTLKTVFVPTKDNRRLLHNFITGVAISVSLYCIALILLQIP 305 >ref|XP_004155531.1| PREDICTED: LOW QUALITY PROTEIN: CAS1 domain-containing protein 1-like [Cucumis sativus] Length = 542 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK++FVPTKDNRRLL N + GA IS+CLY +SL+ L IP Sbjct: 499 LTNTLKTIFVPTKDNRRLLHNFIAGAAISVCLYSMSLVILLIP 541 >ref|XP_004134577.1| PREDICTED: CAS1 domain-containing protein 1-like [Cucumis sativus] Length = 542 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LK++FVPTKDNRRLL N + GA IS+CLY +SL+ L IP Sbjct: 499 LTNTLKTIFVPTKDNRRLLHNFIAGAAISVCLYSMSLVILLIP 541 >ref|XP_007158969.1| hypothetical protein PHAVU_002G197200g [Phaseolus vulgaris] gi|561032384|gb|ESW30963.1| hypothetical protein PHAVU_002G197200g [Phaseolus vulgaris] Length = 543 Score = 62.4 bits (150), Expect = 7e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVFVPTKDNRRLL N +TG I L LY ISLI L IP Sbjct: 497 LTNTLKSVFVPTKDNRRLLHNFITGIVICLSLYCISLILLLIP 539 >ref|XP_006356085.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 541 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVFVPT+DN++LL N + G IS+CLY IS I +QIP Sbjct: 498 LTNTLKSVFVPTRDNQKLLHNFIAGVAISVCLYSISFILIQIP 540 >ref|XP_006356084.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Solanum tuberosum] Length = 542 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIP 411 LTN+LKSVFVPT+DN++LL N + G IS+CLY IS I +QIP Sbjct: 499 LTNTLKSVFVPTRDNQKLLHNFIAGVAISVCLYSISFILIQIP 541 >ref|XP_007025164.1| O-acetyltransferase family protein isoform 5 [Theobroma cacao] gi|508780530|gb|EOY27786.1| O-acetyltransferase family protein isoform 5 [Theobroma cacao] Length = 475 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIPVLKA 399 LTN+LKSVF+PTK+NRRLL N V G ISL LY +LI LQIP +A Sbjct: 429 LTNTLKSVFIPTKENRRLLYNFVAGIAISLILYCTALILLQIPHSRA 475 >ref|XP_007025163.1| O-acetyltransferase family protein isoform 4 [Theobroma cacao] gi|508780529|gb|EOY27785.1| O-acetyltransferase family protein isoform 4 [Theobroma cacao] Length = 444 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -3 Query: 539 LTNSLKSVFVPTKDNRRLLCNVVTGATISLCLYLISLIFLQIPVLKA 399 LTN+LKSVF+PTK+NRRLL N V G ISL LY +LI LQIP +A Sbjct: 398 LTNTLKSVFIPTKENRRLLYNFVAGIAISLILYCTALILLQIPHSRA 444