BLASTX nr result
ID: Sinomenium22_contig00027050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00027050 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC04124.1| Ribonuclease J [Morus notabilis] 60 2e-07 ref|XP_002511207.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >gb|EXC04124.1| Ribonuclease J [Morus notabilis] Length = 872 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 169 MAALSALSVCQCMLSSRLNHRKPFVSCSIASPGVTGIPGHRNKVPRKRTGKREGAGKSME 348 MAAL +LS+C C L R K SCS+ SP G PG + PRKRTG++EG KSME Sbjct: 27 MAALGSLSLCPCSLLWRPKLTKRSFSCSVGSPSSVGTPG--SSAPRKRTGRKEGPKKSME 84 Query: 349 D 351 D Sbjct: 85 D 85 >ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis] gi|223550322|gb|EEF51809.1| conserved hypothetical protein [Ricinus communis] Length = 880 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +1 Query: 169 MAALSALSVCQCML--SSRLNHRKPFVSCSIASPGVTGIPGHRNKVPRKRTGKREGAGKS 342 MAA SA+S+C L R + RK +SCSI S G H +K PRKR+G+ EGAGKS Sbjct: 1 MAAFSAISLCPYSLLHRPRPSTRKYPISCSIGSSSTIG--SHGSKAPRKRSGRMEGAGKS 58 Query: 343 MED 351 MED Sbjct: 59 MED 61