BLASTX nr result
ID: Sinomenium22_contig00026987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00026987 (885 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006297747.1| hypothetical protein CARUB_v10013782mg [Caps... 60 1e-06 gb|AHC32019.1| galacturonokinase [Camellia sinensis] 59 2e-06 >ref|XP_006297747.1| hypothetical protein CARUB_v10013782mg [Capsella rubella] gi|482566456|gb|EOA30645.1| hypothetical protein CARUB_v10013782mg [Capsella rubella] Length = 424 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +2 Query: 572 RVDEVQHPI-HASKTNGNVPSKTLEECGWGTYARGALYALQRGGKQITEVVKG 727 RVDE+QHPI H SK + + PS + E+ WGTYARGA+YALQ K + + + G Sbjct: 85 RVDEIQHPIGHTSKNDASTPSPSKEKSVWGTYARGAVYALQTSKKNLKQGIVG 137 >gb|AHC32019.1| galacturonokinase [Camellia sinensis] Length = 436 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +2 Query: 575 VDEVQHPIHA----SKTNGNVPSKTLEECGWGTYARGALYALQRGGKQITEVVKG 727 VDE++HP H K NG+ SK EEC WG YARGA+YALQ G +T+ + G Sbjct: 89 VDEIKHPKHFVKENDKINGSGSSKQQEECNWGNYARGAIYALQSRGNHLTQGIVG 143