BLASTX nr result
ID: Sinomenium22_contig00026699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00026699 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245046.1| PREDICTED: uncharacterized protein LOC101267... 56 4e-06 ref|XP_006353858.1| PREDICTED: uncharacterized protein LOC102598... 55 1e-05 >ref|XP_004245046.1| PREDICTED: uncharacterized protein LOC101267629 [Solanum lycopersicum] Length = 251 Score = 56.2 bits (134), Expect = 4e-06 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 16/108 (14%) Frame = +3 Query: 102 SENEKPKSWVSNCLACWAFL--------QTPLAPPLAAHSKPSPDIFRHFHNSLTSAARR 257 +E K S VSNCL F Q P + A + +P F HFHNSL S A + Sbjct: 11 AETTKQNSVVSNCLISLPFSFSTPPFFKQLPKSNLQLAQTSSNP--FLHFHNSLLSTAEK 68 Query: 258 FLTNLRSLAAANPVFHQLL-------PINCRNYSS-NSISSHNFAAIL 377 T L S A+ P+F++++ + CR Y + ++S HNFAA+L Sbjct: 69 CFTLLHSFLASQPLFNKIMNFSSHFSQVQCRTYQNMGNLSHHNFAAVL 116 >ref|XP_006353858.1| PREDICTED: uncharacterized protein LOC102598192 [Solanum tuberosum] Length = 251 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/106 (34%), Positives = 53/106 (50%), Gaps = 14/106 (13%) Frame = +3 Query: 102 SENEKPKSWVSNCLACWAF-LQTP-----LAPPLAAHSKPSPDIFRHFHNSLTSAARRFL 263 +E K VSNCL F TP L ++ S + F HFHNSL S A + Sbjct: 11 AETSKQNCVVSNCLISLPFSFSTPPFFKQLPKSNLQLAQTSSNAFLHFHNSLLSTAEKCF 70 Query: 264 TNLRSLAAANPVFHQLL-------PINCRNYSS-NSISSHNFAAIL 377 T L S A+ P+F++++ + CR Y + ++S HNFAA+L Sbjct: 71 TFLHSFLASQPLFNKIMNFSSHFSQVQCRTYQNLGNLSHHNFAAVL 116