BLASTX nr result
ID: Sinomenium22_contig00026423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00026423 (730 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450170.1| hypothetical protein SORBIDRAFT_05g001440 [S... 57 5e-06 >ref|XP_002450170.1| hypothetical protein SORBIDRAFT_05g001440 [Sorghum bicolor] gi|241936013|gb|EES09158.1| hypothetical protein SORBIDRAFT_05g001440 [Sorghum bicolor] Length = 155 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 7/63 (11%) Frame = -1 Query: 475 YREYSGAIKQDEEATPVR----CYTCRCCDKMGM---CIDTNCCYGIKCHVPDKPPDMCF 317 YR S A E A P C CRCC + C+DTNCCY I C++P KP C Sbjct: 77 YRSISPAAMSTEAAAPYEPFEVCRRCRCCVSPSIPSSCVDTNCCYDINCNLPGKPFGTCA 136 Query: 316 FLP 308 FLP Sbjct: 137 FLP 139