BLASTX nr result
ID: Sinomenium22_contig00026313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00026313 (644 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Popu... 61 3e-07 gb|EPS72796.1| hypothetical protein M569_01961, partial [Genlise... 60 4e-07 gb|EYU30342.1| hypothetical protein MIMGU_mgv1a0026502mg, partia... 60 6e-07 emb|CBI31244.3| unnamed protein product [Vitis vinifera] 60 7e-07 ref|XP_002271330.1| PREDICTED: high affinity cationic amino acid... 60 7e-07 gb|EMT08345.1| High affinity cationic amino acid transporter 1 [... 59 1e-06 gb|EMS50997.1| High affinity cationic amino acid transporter 1 [... 59 1e-06 ref|XP_002271182.2| PREDICTED: uncharacterized protein LOC100258... 59 1e-06 ref|XP_003559628.1| PREDICTED: low affinity cationic amino acid ... 59 1e-06 dbj|BAJ96937.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 1e-06 emb|CBI31243.3| unnamed protein product [Vitis vinifera] 59 1e-06 gb|EXB68043.1| Cationic amino acid transporter 2 [Morus notabilis] 59 1e-06 ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citr... 59 1e-06 ref|XP_007029985.1| Cationic amino acid transporter 2 isoform 1 ... 59 1e-06 ref|XP_002325438.1| cationic amino acid transporter 3 family pro... 59 1e-06 ref|XP_007204606.1| hypothetical protein PRUPE_ppa002665mg [Prun... 59 2e-06 ref|NP_198510.2| cationic amino acid transporter 3 [Arabidopsis ... 58 2e-06 dbj|BAB11637.1| cationic amino acid transporter-like protein [Ar... 58 2e-06 ref|XP_006339203.1| PREDICTED: cationic amino acid transporter 2... 58 2e-06 ref|XP_006283314.1| hypothetical protein CARUB_v10004353mg [Caps... 58 2e-06 >ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] gi|550316879|gb|EEE99818.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] Length = 643 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +3 Query: 546 REAFGNSAGFICPFVPFLPVACILINVYIMINL 644 R +FG+S GF+CPFVPFLPVACIL+N Y+++NL Sbjct: 559 RHSFGHSGGFVCPFVPFLPVACILVNTYLLVNL 591 >gb|EPS72796.1| hypothetical protein M569_01961, partial [Genlisea aurea] Length = 641 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R FG+S GF+CPFVP LP+ACILINVY++INL Sbjct: 559 DARHTFGHSGGFVCPFVPLLPIACILINVYLLINL 593 >gb|EYU30342.1| hypothetical protein MIMGU_mgv1a0026502mg, partial [Mimulus guttatus] Length = 321 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG++ GFICPFVP LP+ACILINVY++INL Sbjct: 235 DARHSFGHTGGFICPFVPLLPIACILINVYLLINL 269 >emb|CBI31244.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R FG+S GFICPFVP LP+ACILINVY+++NL Sbjct: 533 DARHNFGHSGGFICPFVPLLPIACILINVYLLVNL 567 >ref|XP_002271330.1| PREDICTED: high affinity cationic amino acid transporter 1 [Vitis vinifera] Length = 639 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R FG+S GFICPFVP LP+ACILINVY+++NL Sbjct: 553 DARHNFGHSGGFICPFVPLLPIACILINVYLLVNL 587 >gb|EMT08345.1| High affinity cationic amino acid transporter 1 [Aegilops tauschii] Length = 640 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 546 REAFGNSAGFICPFVPFLPVACILINVYIMINL 644 R +FG+S GF+CPFVPFLPV CILIN Y++INL Sbjct: 526 RHSFGHSGGFMCPFVPFLPVVCILINTYLLINL 558 >gb|EMS50997.1| High affinity cationic amino acid transporter 1 [Triticum urartu] Length = 1241 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 546 REAFGNSAGFICPFVPFLPVACILINVYIMINL 644 R +FG+S GF+CPFVPFLPV CILIN Y++INL Sbjct: 1096 RHSFGHSGGFMCPFVPFLPVVCILINTYLLINL 1128 >ref|XP_002271182.2| PREDICTED: uncharacterized protein LOC100258741 [Vitis vinifera] Length = 1391 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG++ GF+CPFVPFLP ACILIN Y++INL Sbjct: 1303 DARHSFGHTGGFVCPFVPFLPAACILINTYLLINL 1337 >ref|XP_003559628.1| PREDICTED: low affinity cationic amino acid transporter 2-like, partial [Brachypodium distachyon] Length = 626 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 546 REAFGNSAGFICPFVPFLPVACILINVYIMINL 644 R +FG+S GF CPFVPFLPV CILIN Y+MINL Sbjct: 544 RHSFGHSGGFTCPFVPFLPVICILINTYLMINL 576 >dbj|BAJ96937.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 627 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 546 REAFGNSAGFICPFVPFLPVACILINVYIMINL 644 R +FG+S GF+CPFVPFLPV CILIN Y++INL Sbjct: 544 RHSFGHSGGFMCPFVPFLPVVCILINTYLLINL 576 >emb|CBI31243.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG++ GF+CPFVPFLP ACILIN Y++INL Sbjct: 558 DARHSFGHTGGFVCPFVPFLPAACILINTYLLINL 592 >gb|EXB68043.1| Cationic amino acid transporter 2 [Morus notabilis] Length = 642 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R FG++ GFICPFVP LP+ACILINVY++INL Sbjct: 556 DARHNFGHTGGFICPFVPLLPIACILINVYLLINL 590 >ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] gi|568850985|ref|XP_006479175.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Citrus sinensis] gi|557545763|gb|ESR56741.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] Length = 661 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 E R FG++ GF+CPFVP LP+ACILINVY++INL Sbjct: 558 EARHNFGHAGGFMCPFVPLLPIACILINVYLLINL 592 >ref|XP_007029985.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|590640566|ref|XP_007029987.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|508718590|gb|EOY10487.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|508718592|gb|EOY10489.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] Length = 640 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R FG++ GFICPFVP LP+ACILINVY++INL Sbjct: 555 DARHNFGHTGGFICPFVPLLPIACILINVYLLINL 589 >ref|XP_002325438.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] gi|222862313|gb|EEE99819.1| cationic amino acid transporter 3 family protein [Populus trichocarpa] Length = 641 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG+S GFICPFVP LP+ CIL+N+Y++INL Sbjct: 555 DARHSFGHSGGFICPFVPLLPIVCILVNIYLLINL 589 >ref|XP_007204606.1| hypothetical protein PRUPE_ppa002665mg [Prunus persica] gi|462400137|gb|EMJ05805.1| hypothetical protein PRUPE_ppa002665mg [Prunus persica] Length = 647 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 E R FG++ GFICPFVP LP+ CILINVY++INL Sbjct: 561 EARHNFGHTGGFICPFVPLLPIVCILINVYLLINL 595 >ref|NP_198510.2| cationic amino acid transporter 3 [Arabidopsis thaliana] gi|75299609|sp|Q8GYB4.1|CAAT3_ARATH RecName: Full=Cationic amino acid transporter 3, mitochondrial; Flags: Precursor gi|26450566|dbj|BAC42395.1| putative cationic amino acid transporter [Arabidopsis thaliana] gi|332006747|gb|AED94130.1| cationic amino acid transporter 3 [Arabidopsis thaliana] Length = 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG+S GFICPFVP LP+ CILIN+Y+++NL Sbjct: 523 DARHSFGHSGGFICPFVPLLPIVCILINMYLLVNL 557 >dbj|BAB11637.1| cationic amino acid transporter-like protein [Arabidopsis thaliana] Length = 616 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG+S GFICPFVP LP+ CILIN+Y+++NL Sbjct: 530 DARHSFGHSGGFICPFVPLLPIVCILINMYLLVNL 564 >ref|XP_006339203.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Solanum tuberosum] Length = 649 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG++ GF CPFVP LP+ACILINVY++INL Sbjct: 562 DARHSFGHTGGFTCPFVPLLPIACILINVYLLINL 596 >ref|XP_006283314.1| hypothetical protein CARUB_v10004353mg [Capsella rubella] gi|482552019|gb|EOA16212.1| hypothetical protein CARUB_v10004353mg [Capsella rubella] Length = 635 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +3 Query: 540 ELREAFGNSAGFICPFVPFLPVACILINVYIMINL 644 + R +FG+S GFICPFVP LP+ CILIN+Y+++NL Sbjct: 549 DARHSFGHSGGFICPFVPLLPIVCILINMYLLVNL 583