BLASTX nr result
ID: Sinomenium22_contig00025930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00025930 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9LSP8.1|CMTA6_ARATH RecName: Full=Calmodulin-binding transcr... 64 3e-08 ref|XP_006406788.1| hypothetical protein EUTSA_v10020047mg [Eutr... 64 3e-08 ref|XP_006406787.1| hypothetical protein EUTSA_v10020047mg [Eutr... 64 3e-08 ref|NP_188319.2| calmodulin-binding transcription activator [Ara... 64 3e-08 ref|XP_002519198.1| calmodulin-binding transcription activator (... 63 5e-08 ref|XP_006414383.1| hypothetical protein EUTSA_v10024342mg [Eutr... 62 6e-08 ref|XP_002883035.1| calmodulin-binding protein [Arabidopsis lyra... 62 1e-07 ref|XP_006296968.1| hypothetical protein CARUB_v10012963mg [Caps... 61 1e-07 ref|XP_006349832.1| PREDICTED: calmodulin-binding transcription ... 60 2e-07 ref|XP_006349831.1| PREDICTED: calmodulin-binding transcription ... 60 2e-07 ref|XP_006282550.1| hypothetical protein CARUB_v10004090mg [Caps... 60 2e-07 ref|NP_001266140.1| calmodulin-binding transcription factor SR3L... 60 2e-07 ref|XP_002314926.1| hypothetical protein POPTR_0010s15160g [Popu... 60 2e-07 gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Mor... 60 3e-07 ref|XP_006600368.1| PREDICTED: calmodulin-binding transcription ... 60 3e-07 ref|XP_006600367.1| PREDICTED: calmodulin-binding transcription ... 60 3e-07 ref|XP_006584008.1| PREDICTED: calmodulin-binding transcription ... 60 3e-07 ref|XP_006584007.1| PREDICTED: calmodulin-binding transcription ... 60 3e-07 ref|XP_006584006.1| PREDICTED: calmodulin-binding transcription ... 60 3e-07 ref|XP_007154355.1| hypothetical protein PHAVU_003G111900g [Phas... 60 3e-07 >sp|Q9LSP8.1|CMTA6_ARATH RecName: Full=Calmodulin-binding transcription activator 6; AltName: Full=Ethylene-induced calmodulin-binding protein 5; Short=EICBP5; AltName: Full=Ethylene-induced calmodulin-binding protein e; Short=EICBP.e; AltName: Full=Signal-responsive protein 3 gi|7670023|dbj|BAA94977.1| transcription factor-like protein [Arabidopsis thaliana] gi|41056731|gb|AAR98748.1| ethylene-induced calmodulin-binding protein 5 [Arabidopsis thaliana] Length = 838 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VGNEERIHVYYAH +DN++FVR CYWL DK R Sbjct: 83 HLKVGNEERIHVYYAHGEDNTTFVRRCYWLLDKAR 117 >ref|XP_006406788.1| hypothetical protein EUTSA_v10020047mg [Eutrema salsugineum] gi|557107934|gb|ESQ48241.1| hypothetical protein EUTSA_v10020047mg [Eutrema salsugineum] Length = 861 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VGNEERIHVYYAH +DN++FVR CYWL DK R Sbjct: 100 HLKVGNEERIHVYYAHGEDNTTFVRRCYWLLDKAR 134 >ref|XP_006406787.1| hypothetical protein EUTSA_v10020047mg [Eutrema salsugineum] gi|557107933|gb|ESQ48240.1| hypothetical protein EUTSA_v10020047mg [Eutrema salsugineum] Length = 834 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VGNEERIHVYYAH +DN++FVR CYWL DK R Sbjct: 73 HLKVGNEERIHVYYAHGEDNTTFVRRCYWLLDKAR 107 >ref|NP_188319.2| calmodulin-binding transcription activator [Arabidopsis thaliana] gi|332642365|gb|AEE75886.1| calmodulin-binding transcription activator [Arabidopsis thaliana] Length = 845 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VGNEERIHVYYAH +DN++FVR CYWL DK R Sbjct: 100 HLKVGNEERIHVYYAHGEDNTTFVRRCYWLLDKAR 134 >ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Length = 918 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH +DNS+FVR CYWL DK Sbjct: 90 HLKVGNEERIHVYYAHGEDNSTFVRRCYWLLDK 122 >ref|XP_006414383.1| hypothetical protein EUTSA_v10024342mg [Eutrema salsugineum] gi|557115553|gb|ESQ55836.1| hypothetical protein EUTSA_v10024342mg [Eutrema salsugineum] Length = 917 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DDN +FVR CYWL DK Sbjct: 100 HLKVGNEERIHVYYAHGDDNPTFVRRCYWLLDK 132 >ref|XP_002883035.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328875|gb|EFH59294.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata] Length = 857 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VG+EERIHVYYAH +DN++FVR CYWL DK R Sbjct: 100 HLKVGDEERIHVYYAHGEDNTTFVRRCYWLLDKAR 134 >ref|XP_006296968.1| hypothetical protein CARUB_v10012963mg [Capsella rubella] gi|482565677|gb|EOA29866.1| hypothetical protein CARUB_v10012963mg [Capsella rubella] Length = 858 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDKCR 246 H VGNEERIHVYYAH +D ++FVR CYWL DK R Sbjct: 100 HLKVGNEERIHVYYAHGEDKTTFVRRCYWLLDKAR 134 >ref|XP_006349832.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X2 [Solanum tuberosum] Length = 914 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGN+ERIHVYYAH +DN++FVR CYWL DK Sbjct: 106 HLKVGNDERIHVYYAHGEDNTTFVRRCYWLLDK 138 >ref|XP_006349831.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X1 [Solanum tuberosum] Length = 915 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGN+ERIHVYYAH +DN++FVR CYWL DK Sbjct: 106 HLKVGNDERIHVYYAHGEDNTTFVRRCYWLLDK 138 >ref|XP_006282550.1| hypothetical protein CARUB_v10004090mg [Capsella rubella] gi|482551255|gb|EOA15448.1| hypothetical protein CARUB_v10004090mg [Capsella rubella] Length = 922 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH +DN +FVR CYWL DK Sbjct: 100 HLKVGNEERIHVYYAHGNDNPTFVRRCYWLLDK 132 >ref|NP_001266140.1| calmodulin-binding transcription factor SR3L [Solanum lycopersicum] gi|365927836|gb|AEX07778.1| calmodulin-binding transcription factor SR3L [Solanum lycopersicum] Length = 910 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGN+ERIHVYYAH +DN++FVR CYWL DK Sbjct: 100 HLKVGNDERIHVYYAHGEDNTTFVRRCYWLLDK 132 >ref|XP_002314926.1| hypothetical protein POPTR_0010s15160g [Populus trichocarpa] gi|222863966|gb|EEF01097.1| hypothetical protein POPTR_0010s15160g [Populus trichocarpa] Length = 915 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 100 HLKVGNEERIHVYYAHGQDNQTFVRRCYWLLDK 132 >gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Morus notabilis] Length = 1036 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 96 HLKVGNEERIHVYYAHGQDNPTFVRRCYWLLDK 128 >ref|XP_006600368.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X2 [Glycine max] Length = 893 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 72 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 104 >ref|XP_006600367.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X1 [Glycine max] Length = 922 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 101 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 133 >ref|XP_006584008.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X3 [Glycine max] Length = 893 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 72 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 104 >ref|XP_006584007.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X2 [Glycine max] Length = 904 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 83 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 115 >ref|XP_006584006.1| PREDICTED: calmodulin-binding transcription activator 5-like isoform X1 [Glycine max] Length = 921 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 100 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 132 >ref|XP_007154355.1| hypothetical protein PHAVU_003G111900g [Phaseolus vulgaris] gi|561027709|gb|ESW26349.1| hypothetical protein PHAVU_003G111900g [Phaseolus vulgaris] Length = 922 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 142 HYNVGNEERIHVYYAHRDDNSSFVRHCYWLPDK 240 H VGNEERIHVYYAH DN +FVR CYWL DK Sbjct: 100 HLKVGNEERIHVYYAHGQDNPNFVRRCYWLLDK 132