BLASTX nr result
ID: Sinomenium22_contig00025771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00025771 (637 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79451.1| hypothetical protein VITISV_001677 [Vitis vinifera] 43 2e-08 emb|CAN81927.1| hypothetical protein VITISV_025281 [Vitis vinifera] 50 3e-08 >emb|CAN79451.1| hypothetical protein VITISV_001677 [Vitis vinifera] Length = 805 Score = 43.1 bits (100), Expect(2) = 2e-08 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -2 Query: 609 H*FDVWNLDSSCSYHLFPTCEWFDTFSSHNS 517 H D W LDS+CSYH+ P +WF+T+ S NS Sbjct: 140 HLTDYWILDSACSYHMTPNKDWFNTYRSVNS 170 Score = 41.6 bits (96), Expect(2) = 2e-08 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 521 IVSNDASYKVIGICTIKIKMFNEVVRTLDDVRNVLALKR 405 ++ NDAS KV GI I IKMF+ VVRTL DVR+V L + Sbjct: 174 LMGNDASCKVAGIGNIIIKMFDGVVRTLCDVRHVSDLXK 212 >emb|CAN81927.1| hypothetical protein VITISV_025281 [Vitis vinifera] Length = 425 Score = 50.1 bits (118), Expect(2) = 3e-08 Identities = 22/40 (55%), Positives = 33/40 (82%) Frame = -3 Query: 521 IVSNDASYKVIGICTIKIKMFNEVVRTLDDVRNVLALKRI 402 ++ N+ +YKV+GICTI+IKM + ++RTL DVR+V LK+I Sbjct: 301 LMRNNVAYKVVGICTIQIKMHDGIIRTLIDVRHVPELKKI 340 Score = 34.3 bits (77), Expect(2) = 3e-08 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 600 DVWNLDSSCSYHLFPTCEWFDTF 532 D W LD CSYH+ P WF+T+ Sbjct: 270 DEWILDLGCSYHMSPNRAWFNTY 292