BLASTX nr result
ID: Sinomenium22_contig00025668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00025668 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838782.1| hypothetical protein AMTR_s00002p00258740 [A... 58 3e-12 ref|XP_002321756.1| regulator of chromosome condensation family ... 59 4e-10 ref|XP_004489969.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 55 7e-09 ref|XP_006483251.1| PREDICTED: probable E3 ubiquitin-protein lig... 65 1e-08 ref|XP_006438569.1| hypothetical protein CICLE_v10031688mg [Citr... 65 1e-08 ref|XP_006438568.1| hypothetical protein CICLE_v10031688mg [Citr... 65 1e-08 ref|XP_003613573.1| RCC1 and BTB domain-containing protein [Medi... 56 1e-08 ref|XP_007044368.1| Regulator of chromosome condensation family ... 46 3e-08 ref|XP_007044369.1| Regulator of chromosome condensation family ... 46 3e-08 ref|XP_002520151.1| protein with unknown function [Ricinus commu... 58 1e-06 ref|XP_007157407.1| hypothetical protein PHAVU_002G067400g [Phas... 57 2e-06 ref|XP_004155394.1| PREDICTED: probable E3 ubiquitin-protein lig... 57 3e-06 ref|XP_004135464.1| PREDICTED: probable E3 ubiquitin-protein lig... 57 3e-06 ref|XP_007157537.1| hypothetical protein PHAVU_002G078000g [Phas... 56 6e-06 ref|XP_007157536.1| hypothetical protein PHAVU_002G078000g [Phas... 55 8e-06 emb|CBI32027.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002269566.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 55 8e-06 >ref|XP_006838782.1| hypothetical protein AMTR_s00002p00258740 [Amborella trichopoda] gi|548841288|gb|ERN01351.1| hypothetical protein AMTR_s00002p00258740 [Amborella trichopoda] Length = 405 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 VDGHLYTW GFN A +PQL + LKF Q +LGWNHA Sbjct: 221 VDGHLYTWGRGFNRAKHNQVPQLLSTSLKFSQVSLGWNHA 260 Score = 39.3 bits (90), Expect(2) = 3e-12 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = -2 Query: 402 SCSWMESCSIIDRSEAFMLGGNHHGMLTDPQKLILEKSCRIQISPYQCSDC 250 S W + + D E FMLGGNHHG L+ + +E Q P C+ C Sbjct: 254 SLGWNHALLLTDLGEVFMLGGNHHGKLSGSESAPME-----QGRPLNCATC 299 >ref|XP_002321756.1| regulator of chromosome condensation family protein [Populus trichocarpa] gi|222868752|gb|EEF05883.1| regulator of chromosome condensation family protein [Populus trichocarpa] Length = 390 Score = 58.9 bits (141), Expect(2) = 4e-10 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNH 381 DGHLYTW GF GASD N PQL S L+ +AALGWNH Sbjct: 226 DGHLYTWGRGFAGASDANFPQLSLSSLRCTKAALGWNH 263 Score = 30.8 bits (68), Expect(2) = 4e-10 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 393 WMESCSIIDRSEAFMLGGNHHGMLTDPQKL 304 W + E MLGGN+HG+L D +K+ Sbjct: 261 WNHGLLLTGDEEVLMLGGNYHGVLCDLEKM 290 >ref|XP_004489969.1| PREDICTED: ultraviolet-B receptor UVR8-like [Cicer arietinum] Length = 587 Score = 55.5 bits (132), Expect(2) = 7e-09 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNH 381 VDGHL+TW GF G D ++PQ S LKF +A LGWNH Sbjct: 426 VDGHLFTWGRGFKGFEDSHIPQSLNSTLKFTKATLGWNH 464 Score = 30.0 bits (66), Expect(2) = 7e-09 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 393 WMESCSIIDRSEAFMLGGNHHGMLTD 316 W ++ E +MLGGNH G+L+D Sbjct: 462 WNHGLAMTGEGEVYMLGGNHLGVLSD 487 >ref|XP_006483251.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Citrus sinensis] Length = 410 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +GHLYTW GFN SDVN PQ PS L F QAALGWNHA Sbjct: 247 EGHLYTWGRGFNSTSDVNCPQSLPSSLSFSQAALGWNHA 285 >ref|XP_006438569.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] gi|557540765|gb|ESR51809.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] Length = 328 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +GHLYTW GFN SDVN PQ PS L F QAALGWNHA Sbjct: 247 EGHLYTWGRGFNSTSDVNCPQSLPSSLSFSQAALGWNHA 285 >ref|XP_006438568.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] gi|557540764|gb|ESR51808.1| hypothetical protein CICLE_v10031688mg [Citrus clementina] Length = 410 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +GHLYTW GFN SDVN PQ PS L F QAALGWNHA Sbjct: 247 EGHLYTWGRGFNSTSDVNCPQSLPSSLSFSQAALGWNHA 285 >ref|XP_003613573.1| RCC1 and BTB domain-containing protein [Medicago truncatula] gi|355514908|gb|AES96531.1| RCC1 and BTB domain-containing protein [Medicago truncatula] Length = 615 Score = 55.8 bits (133), Expect(2) = 1e-08 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 VDGHLYTW GF G D +LPQ S KF + LGWNHA Sbjct: 454 VDGHLYTWGRGFKGYEDSHLPQCLNSTSKFTKVTLGWNHA 493 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 393 WMESCSIIDRSEAFMLGGNHHGMLTD 316 W + ++ + +MLGGNH G+L+D Sbjct: 490 WNHALAMTGEGKVYMLGGNHLGVLSD 515 >ref|XP_007044368.1| Regulator of chromosome condensation family protein isoform 1 [Theobroma cacao] gi|508708303|gb|EOY00200.1| Regulator of chromosome condensation family protein isoform 1 [Theobroma cacao] Length = 444 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +G LY W GF SD +PQ PSPL +A LGWNHA Sbjct: 238 EGQLYIWGRGFGATSDFLIPQHIPSPL-LSKAVLGWNHA 275 Score = 37.7 bits (86), Expect(2) = 3e-08 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = -2 Query: 393 WMESCSIIDRSEAFMLGGNHHGMLTDPQKL 304 W + + D E +MLGG+HHG+L++P+K+ Sbjct: 272 WNHALILSDDGEVYMLGGSHHGVLSNPEKM 301 >ref|XP_007044369.1| Regulator of chromosome condensation family protein isoform 2 [Theobroma cacao] gi|508708304|gb|EOY00201.1| Regulator of chromosome condensation family protein isoform 2 [Theobroma cacao] Length = 400 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +G LY W GF SD +PQ PSPL +A LGWNHA Sbjct: 238 EGQLYIWGRGFGATSDFLIPQHIPSPL-LSKAVLGWNHA 275 Score = 37.7 bits (86), Expect(2) = 3e-08 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = -2 Query: 393 WMESCSIIDRSEAFMLGGNHHGMLTDPQKL 304 W + + D E +MLGG+HHG+L++P+K+ Sbjct: 272 WNHALILSDDGEVYMLGGSHHGVLSNPEKM 301 >ref|XP_002520151.1| protein with unknown function [Ricinus communis] gi|223540643|gb|EEF42206.1| protein with unknown function [Ricinus communis] Length = 387 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 VDGHLYTW GF G SDV P+ S L+FI+ ALGWNHA Sbjct: 231 VDGHLYTWGRGFPGTSDVFTPRHLVSSLQFIKVALGWNHA 270 >ref|XP_007157407.1| hypothetical protein PHAVU_002G067400g [Phaseolus vulgaris] gi|561030822|gb|ESW29401.1| hypothetical protein PHAVU_002G067400g [Phaseolus vulgaris] Length = 390 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 VDGH+YTW GF G D +P S LKFI+ ALGWNHA Sbjct: 228 VDGHVYTWGRGFKGFEDAYVPHCLSSSLKFIKVALGWNHA 267 >ref|XP_004155394.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis sativus] Length = 577 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +GHLYTW GF SDV PQ PSP F + ALGWNHA Sbjct: 442 EGHLYTWGRGFKSTSDVYSPQHLPSPSSFSKVALGWNHA 480 >ref|XP_004135464.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Cucumis sativus] Length = 608 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 +GHLYTW GF SDV PQ PSP F + ALGWNHA Sbjct: 442 EGHLYTWGRGFKSTSDVYSPQHLPSPSSFSKVALGWNHA 480 >ref|XP_007157537.1| hypothetical protein PHAVU_002G078000g [Phaseolus vulgaris] gi|561030952|gb|ESW29531.1| hypothetical protein PHAVU_002G078000g [Phaseolus vulgaris] Length = 383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/64 (39%), Positives = 34/64 (53%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHAXXXXXXXXXXLVGTIMGC*P 318 VDG +YTW GF G D ++P S LKFI+ ALGWNHA ++ + P Sbjct: 228 VDGQVYTWGRGFKGFEDAHVPHCLSSSLKFIKVALGWNHALAMSGGNHLGVLSDLQNISP 287 Query: 317 TPKN 306 P++ Sbjct: 288 HPRH 291 >ref|XP_007157536.1| hypothetical protein PHAVU_002G078000g [Phaseolus vulgaris] gi|561030951|gb|ESW29530.1| hypothetical protein PHAVU_002G078000g [Phaseolus vulgaris] Length = 275 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 497 VDGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNHA 378 VDG +YTW GF G D ++P S LKFI+ ALGWNHA Sbjct: 228 VDGQVYTWGRGFKGFEDAHVPHCLSSSLKFIKVALGWNHA 267 >emb|CBI32027.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNH 381 +GHLYTW GF SDV+ P+ PS L F Q ALGWNH Sbjct: 237 NGHLYTWGRGFGSTSDVHCPRCLPSSLCFTQVALGWNH 274 >ref|XP_002269566.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Vitis vinifera] Length = 400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -3 Query: 494 DGHLYTWRSGFNGASDVNLPQLFPSPLKFIQAALGWNH 381 +GHLYTW GF SDV+ P+ PS L F Q ALGWNH Sbjct: 224 NGHLYTWGRGFGSTSDVHCPRCLPSSLCFTQVALGWNH 261