BLASTX nr result
ID: Sinomenium22_contig00025526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00025526 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842448.1| hypothetical protein AMTR_s00077p00053020 [A... 58 1e-06 >ref|XP_006842448.1| hypothetical protein AMTR_s00077p00053020 [Amborella trichopoda] gi|548844534|gb|ERN04123.1| hypothetical protein AMTR_s00077p00053020 [Amborella trichopoda] Length = 377 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 4/63 (6%) Frame = -1 Query: 177 MDNAQDPCNLEARGDERREQVSDDCSSSSPD----NTTYHLFDHQRSIRQMMGGGRAADV 10 MD Q+ ++A D R++++ + SS S D + Y LFD QRSIR +MGGG+AADV Sbjct: 64 MDILQEVSKIDANADARKDKLPEQSSSGSSDCIPLSKGYKLFDRQRSIRHVMGGGKAADV 123 Query: 9 FLW 1 LW Sbjct: 124 ILW 126