BLASTX nr result
ID: Sinomenium22_contig00023721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00023721 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009311.1| Radical SAM superfamily protein [Theobroma c... 62 1e-07 ref|XP_003544231.1| PREDICTED: uncharacterized protein LOC100818... 61 1e-07 ref|XP_002283725.1| PREDICTED: ribosomal RNA large subunit methy... 61 1e-07 ref|XP_006411195.1| hypothetical protein EUTSA_v10016689mg [Eutr... 61 2e-07 ref|XP_006411193.1| hypothetical protein EUTSA_v10016689mg [Eutr... 61 2e-07 ref|XP_006294270.1| hypothetical protein CARUB_v10023268mg [Caps... 61 2e-07 ref|NP_850319.1| radical SAM domain-containing protein [Arabidop... 61 2e-07 ref|XP_003519346.1| PREDICTED: uncharacterized protein LOC100801... 61 2e-07 ref|XP_002879809.1| radical SAM domain-containing protein [Arabi... 61 2e-07 ref|NP_565909.1| radical SAM domain-containing protein [Arabidop... 61 2e-07 ref|XP_007141879.1| hypothetical protein PHAVU_008G2333000g, par... 60 3e-07 ref|XP_004307502.1| PREDICTED: probable dual-specificity RNA met... 60 3e-07 ref|XP_002311170.2| hypothetical protein POPTR_0008s05660g [Popu... 60 4e-07 ref|XP_004169015.1| PREDICTED: probable dual-specificity RNA met... 60 4e-07 ref|XP_004147696.1| PREDICTED: probable dual-specificity RNA met... 60 4e-07 ref|XP_002533149.1| catalytic, putative [Ricinus communis] gi|22... 60 4e-07 gb|EXC30493.1| Ribosomal RNA large subunit methyltransferase N [... 59 7e-07 ref|XP_007218085.1| hypothetical protein PRUPE_ppa006433mg [Prun... 59 7e-07 ref|XP_006366986.1| PREDICTED: uncharacterized protein LOC102604... 58 1e-06 ref|XP_004490899.1| PREDICTED: probable dual-specificity RNA met... 58 1e-06 >ref|XP_007009311.1| Radical SAM superfamily protein [Theobroma cacao] gi|508726224|gb|EOY18121.1| Radical SAM superfamily protein [Theobroma cacao] Length = 456 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/70 (48%), Positives = 41/70 (58%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIHIYGSFIHTQSFASSTIFCTV 255 QVGCPLRCSFCATGK GYS NL++H IIEQV Y + Q A IF Sbjct: 194 QVGCPLRCSFCATGKGGYSRNLRRHEIIEQV----------YDPRLCEQVLAIEDIFKRR 243 Query: 256 ILDFVYAGLG 285 + + V+ G+G Sbjct: 244 VTNVVFMGMG 253 >ref|XP_003544231.1| PREDICTED: uncharacterized protein LOC100818638 [Glycine max] Length = 416 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 KGL L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E Sbjct: 144 KGLTRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIE 190 >ref|XP_002283725.1| PREDICTED: ribosomal RNA large subunit methyltransferase N [Vitis vinifera] gi|296086245|emb|CBI31686.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 QVGCPLRCSFCATGK GYS NLQ+H I+EQV+ E Sbjct: 154 QVGCPLRCSFCATGKGGYSRNLQRHEIVEQVLAIE 188 >ref|XP_006411195.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] gi|557112364|gb|ESQ52648.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] Length = 430 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 158 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 209 >ref|XP_006411193.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] gi|567214647|ref|XP_006411194.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] gi|557112362|gb|ESQ52646.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] gi|557112363|gb|ESQ52647.1| hypothetical protein EUTSA_v10016689mg [Eutrema salsugineum] Length = 424 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 158 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 209 >ref|XP_006294270.1| hypothetical protein CARUB_v10023268mg [Capsella rubella] gi|482562978|gb|EOA27168.1| hypothetical protein CARUB_v10023268mg [Capsella rubella] Length = 428 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 162 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 213 >ref|NP_850319.1| radical SAM domain-containing protein [Arabidopsis thaliana] gi|330254611|gb|AEC09705.1| radical SAM domain-containing protein [Arabidopsis thaliana] Length = 431 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 165 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 216 >ref|XP_003519346.1| PREDICTED: uncharacterized protein LOC100801657 [Glycine max] Length = 416 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 KGL L+ QVGCPLRCSFCATGK G+S NLQ+H I+EQV+ E Sbjct: 144 KGLTRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIVEQVLAIE 190 >ref|XP_002879809.1| radical SAM domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325648|gb|EFH56068.1| radical SAM domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 419 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 153 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 204 >ref|NP_565909.1| radical SAM domain-containing protein [Arabidopsis thaliana] gi|15809964|gb|AAL06909.1| At2g39670/F17A14.4 [Arabidopsis thaliana] gi|17065474|gb|AAL32891.1| Unknown protein [Arabidopsis thaliana] gi|20197047|gb|AAB97122.2| expressed protein [Arabidopsis thaliana] gi|23197704|gb|AAN15379.1| Unknown protein [Arabidopsis thaliana] gi|330254610|gb|AEC09704.1| radical SAM domain-containing protein [Arabidopsis thaliana] Length = 428 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG+ L+ QVGCPLRCSFCATGK G+S NLQ+H IIEQV+ E + H Sbjct: 162 KGITRLTACVSS-QVGCPLRCSFCATGKGGFSRNLQRHEIIEQVLAIEDVFKH 213 >ref|XP_007141879.1| hypothetical protein PHAVU_008G2333000g, partial [Phaseolus vulgaris] gi|561015012|gb|ESW13873.1| hypothetical protein PHAVU_008G2333000g, partial [Phaseolus vulgaris] Length = 305 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 QVGCPLRCSFCATGK G+S NLQ+H I+EQV+ E + H Sbjct: 156 QVGCPLRCSFCATGKGGFSRNLQRHEIVEQVLAIEEVFKH 195 >ref|XP_004307502.1| PREDICTED: probable dual-specificity RNA methyltransferase RlmN-like [Fragaria vesca subsp. vesca] Length = 414 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KGL L+ QVGCPLRCSFCATGK G+S NL++H I+EQV+ E + H Sbjct: 147 KGLTRLTACVSS-QVGCPLRCSFCATGKGGFSRNLKRHEIVEQVLAIEEIFKH 198 >ref|XP_002311170.2| hypothetical protein POPTR_0008s05660g [Populus trichocarpa] gi|550332493|gb|EEE88537.2| hypothetical protein POPTR_0008s05660g [Populus trichocarpa] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQ----VIRSEILAIHIYGSFIHTQSFASSTI 243 QVGCPLRCSFCATGK G+S NLQ+H I+EQ + +Y ++ Q A I Sbjct: 232 QVGCPLRCSFCATGKGGFSRNLQRHEIVEQHRLGSSGTTSTCSKLYLHVLYAQVLAVEEI 291 Query: 244 FCTVILDFVYAGLG 285 F + + V+ G+G Sbjct: 292 FKHRVTNVVFMGMG 305 >ref|XP_004169015.1| PREDICTED: probable dual-specificity RNA methyltransferase RlmN-like [Cucumis sativus] Length = 422 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 QVGCPLRCSFCATGK G+S NLQ+H I+EQV E + H Sbjct: 163 QVGCPLRCSFCATGKGGFSRNLQRHEIVEQVFAIEDIFNH 202 >ref|XP_004147696.1| PREDICTED: probable dual-specificity RNA methyltransferase RlmN-like [Cucumis sativus] Length = 425 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 QVGCPLRCSFCATGK G+S NLQ+H I+EQV E + H Sbjct: 163 QVGCPLRCSFCATGKGGFSRNLQRHEIVEQVFAIEDIFNH 202 >ref|XP_002533149.1| catalytic, putative [Ricinus communis] gi|223527044|gb|EEF29230.1| catalytic, putative [Ricinus communis] Length = 420 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 QVGCPLRCSFCATGK GYS NL++H I+EQV+ E Sbjct: 167 QVGCPLRCSFCATGKGGYSRNLKRHEIVEQVLAIE 201 >gb|EXC30493.1| Ribosomal RNA large subunit methyltransferase N [Morus notabilis] Length = 440 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 QVGCPLRCSFCATGK G+S NLQ H I+EQV+ E Sbjct: 167 QVGCPLRCSFCATGKGGFSRNLQAHEIVEQVLAIE 201 >ref|XP_007218085.1| hypothetical protein PRUPE_ppa006433mg [Prunus persica] gi|462414547|gb|EMJ19284.1| hypothetical protein PRUPE_ppa006433mg [Prunus persica] Length = 412 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEILAIH 195 KG++ L+ QVGCPLRCSFCATGK G+S NL+ H I+EQV+ E + H Sbjct: 147 KGVMRLTACVSS-QVGCPLRCSFCATGKGGFSRNLKMHEIVEQVLAVEEIFNH 198 >ref|XP_006366986.1| PREDICTED: uncharacterized protein LOC102604953 [Solanum tuberosum] Length = 408 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 76 QVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSEIL 186 QVGCPLRCSFCATGK G+S NL+ H I+EQV+ E L Sbjct: 155 QVGCPLRCSFCATGKGGFSRNLKSHEIVEQVLAIEEL 191 >ref|XP_004490899.1| PREDICTED: probable dual-specificity RNA methyltransferase RlmN-like [Cicer arietinum] Length = 408 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +1 Query: 37 KGLVELSCSPKIVQVGCPLRCSFCATGKRGYSWNLQQHVIIEQVIRSE 180 KG V L+ QVGCPLRCSFCATGK G+S NL+ H I+EQV+ E Sbjct: 140 KGSVRLTACVSS-QVGCPLRCSFCATGKGGFSRNLRSHEIVEQVLAIE 186