BLASTX nr result
ID: Sinomenium22_contig00023299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00023299 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] 59 5e-07 ref|XP_002309173.2| pentatricopeptide repeat-containing family p... 57 4e-06 ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >gb|EXB42398.1| hypothetical protein L484_021993 [Morus notabilis] Length = 494 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -1 Query: 208 LRSASLTH-FRRGGRRRKLPISPYKGKWQQTFNQQAAMEAFKKATVELQQSNLLFALINS 32 +R SLT+ F R + R+ PISPYK KW +TFNQ A++ K+ E + LL L+NS Sbjct: 3 IRPFSLTNKFLR--KHREFPISPYKTKWHETFNQTQALQTLKRHQNE-NPNRLLSLLLNS 59 Query: 31 FSIYACDPTP 2 F+ Y C+PTP Sbjct: 60 FNSYDCNPTP 69 >ref|XP_002309173.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335936|gb|EEE92696.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 490 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 6/79 (7%) Frame = -1 Query: 220 SMVSLRSASLTHFRRGGRRRKLPISPYKGKWQQTFNQQAAMEAFKKATVELQQS------ 59 S S +SAS F R + RK P SPYK +W + FNQQ AM++ K++ ++ Q Sbjct: 3 SCTSKKSASF--FLR--KHRKWPYSPYKARWHRIFNQQQAMQSLKQSALKPPQQESPNKP 58 Query: 58 NLLFALINSFSIYACDPTP 2 +LL +LI+SFSIY +P P Sbjct: 59 HLLSSLIHSFSIYDVEPAP 77 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = -1 Query: 169 RRRKLPISPYKGKWQQTFNQQAAMEAFKKATVELQQSNLLFALINSFSIYACDPTP 2 + RK P+S +K KW QTF+Q A+ K+A Q LL AL+ SF+ Y+C PTP Sbjct: 17 KHRKWPLSSHKTKWHQTFDQDEALRILKQAANPDQPHLLLSALVTSFTAYSCHPTP 72