BLASTX nr result
ID: Sinomenium22_contig00023182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00023182 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364687.1| PREDICTED: uncharacterized WD repeat-contain... 62 1e-07 gb|AFX67015.1| WD-repeat protein, partial [Solanum tuberosum] 61 2e-07 ref|XP_004247992.1| PREDICTED: uncharacterized WD repeat-contain... 60 3e-07 gb|AFK47486.1| unknown [Lotus japonicus] 60 3e-07 gb|EYU32741.1| hypothetical protein MIMGU_mgv1a006804mg [Mimulus... 56 5e-06 ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Popu... 56 6e-06 gb|EXC14269.1| Uncharacterized WD repeat-containing protein [Mor... 55 8e-06 gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlise... 55 8e-06 ref|XP_004296674.1| PREDICTED: uncharacterized WD repeat-contain... 55 8e-06 ref|XP_007222225.1| hypothetical protein PRUPE_ppa005865mg [Prun... 55 8e-06 ref|XP_004252971.1| PREDICTED: uncharacterized WD repeat-contain... 55 8e-06 >ref|XP_006364687.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Solanum tuberosum] Length = 440 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPDDESL+IG+WDR+Y SLL YNRK C YLDS+V Sbjct: 406 SPDDESLYIGIWDRTYGSLLEYNRKHTCRYLDSLV 440 >gb|AFX67015.1| WD-repeat protein, partial [Solanum tuberosum] Length = 312 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPDDESL+IG+WDR+Y SLL YNRK C YLDS V Sbjct: 278 SPDDESLYIGIWDRTYGSLLEYNRKHTCRYLDSFV 312 >ref|XP_004247992.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Solanum lycopersicum] Length = 440 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPDDESL+IG+WDR+Y SLL YNR+ +C YLDS V Sbjct: 406 SPDDESLYIGIWDRTYGSLLEYNRRHSCRYLDSFV 440 >gb|AFK47486.1| unknown [Lotus japonicus] Length = 242 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSI 104 SPD ESLFIGVWDR+Y SLL YNR+R+C YLDS+ Sbjct: 209 SPDTESLFIGVWDRTYGSLLQYNRRRSCMYLDSL 242 >gb|EYU32741.1| hypothetical protein MIMGU_mgv1a006804mg [Mimulus guttatus] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPDDES++IG+WDR+Y SLL YNR+ YLDS++ Sbjct: 396 SPDDESIYIGIWDRTYASLLQYNRRHTYEYLDSLI 430 >ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] gi|222854709|gb|EEE92256.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] Length = 448 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPD ESLFIGVWDR+Y SLL YNR+R+ +Y+DS++ Sbjct: 414 SPDTESLFIGVWDRTYGSLLQYNRRRSYSYVDSLM 448 >gb|EXC14269.1| Uncharacterized WD repeat-containing protein [Morus notabilis] Length = 440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDS 101 SPDDESL+IG+WDR+Y SLL YNR+ YLDS Sbjct: 406 SPDDESLYIGIWDRTYASLLQYNRRHTYGYLDS 438 >gb|EPS58082.1| hypothetical protein M569_16734, partial [Genlisea aurea] Length = 166 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDSIV 107 SPD ESLFIGVWDR+Y SLL YNR R +YLDSI+ Sbjct: 132 SPDTESLFIGVWDRTYGSLLQYNRCRNYSYLDSII 166 >ref|XP_004296674.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Fragaria vesca subsp. vesca] Length = 444 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDS 101 SPDDESL+IG+WDR+Y SLL YNR+ YLDS Sbjct: 410 SPDDESLYIGIWDRTYASLLQYNRRHTYGYLDS 442 >ref|XP_007222225.1| hypothetical protein PRUPE_ppa005865mg [Prunus persica] gi|462419161|gb|EMJ23424.1| hypothetical protein PRUPE_ppa005865mg [Prunus persica] Length = 440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLDS 101 SPDDESL+IG+WDR+Y SLL YNR+ YLDS Sbjct: 406 SPDDESLYIGIWDRTYASLLQYNRRHTYGYLDS 438 >ref|XP_004252971.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Solanum lycopersicum] Length = 440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +3 Query: 3 SPDDESLFIGVWDRSYISLLHYNRKRACAYLD 98 SPDDESL+IG+WDR+Y SLL YNR+R+ Y+D Sbjct: 406 SPDDESLYIGIWDRTYASLLQYNRRRSSVYVD 437