BLASTX nr result
ID: Sinomenium22_contig00023161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00023161 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268993.1| PREDICTED: NEDD8 ultimate buster 1 [Vitis vi... 70 4e-10 ref|XP_002532310.1| NEDD8 ultimate buster, putative [Ricinus com... 69 9e-10 ref|XP_006453132.1| hypothetical protein CICLE_v10007887mg [Citr... 68 1e-09 ref|XP_004287245.1| PREDICTED: NEDD8 ultimate buster 1-like [Fra... 67 2e-09 ref|XP_002527272.1| conserved hypothetical protein [Ricinus comm... 66 4e-09 ref|XP_006389398.1| hypothetical protein POPTR_0025s00350g [Popu... 66 6e-09 ref|XP_007013627.1| Ubiquitin-associated (UBA)/TS-N domain-conta... 66 6e-09 ref|XP_007201940.1| hypothetical protein PRUPE_ppa004340mg [Prun... 65 1e-08 ref|XP_001781827.1| predicted protein [Physcomitrella patens] gi... 64 2e-08 ref|XP_006852823.1| hypothetical protein AMTR_s00033p00177630 [A... 64 2e-08 ref|XP_004242723.1| PREDICTED: NEDD8 ultimate buster 1-like [Sol... 62 8e-08 ref|XP_006381076.1| ubiquitin-associated domain-containing famil... 61 1e-07 ref|XP_006381075.1| hypothetical protein POPTR_0006s06020g [Popu... 61 1e-07 ref|XP_006359510.1| PREDICTED: NEDD8 ultimate buster 1-like [Sol... 61 2e-07 ref|XP_004488510.1| PREDICTED: NEDD8 ultimate buster 1-like [Cic... 60 2e-07 ref|XP_003546581.1| PREDICTED: uncharacterized protein LOC100804... 60 2e-07 ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fra... 60 3e-07 ref|XP_002960892.1| hypothetical protein SELMODRAFT_73901 [Selag... 60 4e-07 ref|XP_002967121.1| hypothetical protein SELMODRAFT_169084 [Sela... 60 4e-07 ref|XP_004139279.1| PREDICTED: NEDD8 ultimate buster 1-like [Cuc... 59 5e-07 >ref|XP_002268993.1| PREDICTED: NEDD8 ultimate buster 1 [Vitis vinifera] gi|296084548|emb|CBI25569.3| unnamed protein product [Vitis vinifera] Length = 552 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQEL-TGDPFSDYDLEVTKEGEAITEYLALVASAQSK*K 249 G S + EERD+EMED +A++L GD FSDYD+EVTKEGEAI EYL L+ASA K Sbjct: 490 GSSSAKKGEERDLEMEDELAEDLRNGDAFSDYDMEVTKEGEAINEYLTLLASADQSEK 547 >ref|XP_002532310.1| NEDD8 ultimate buster, putative [Ricinus communis] gi|223527979|gb|EEF30062.1| NEDD8 ultimate buster, putative [Ricinus communis] Length = 559 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/56 (64%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASAQS 240 EGPS E E+RD+EMED IA+E+ GD SDYD+EVTKEGEAI EY+AL+ S S Sbjct: 497 EGPSASEV-EQRDLEMEDTIAEEIAKGDALSDYDIEVTKEGEAINEYMALLNSVDS 551 >ref|XP_006453132.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] gi|568840834|ref|XP_006474370.1| PREDICTED: NEDD8 ultimate buster 1-like [Citrus sinensis] gi|557556358|gb|ESR66372.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] Length = 561 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELTGDPFSDYDLEVTKEGEAITEYLALVAS 231 E S E RDVEMED +A +LTGD F+DYD+EVTKEGEAI+EYL+L+ S Sbjct: 499 EETSATEDVNGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLES 550 >ref|XP_004287245.1| PREDICTED: NEDD8 ultimate buster 1-like [Fragaria vesca subsp. vesca] Length = 560 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASA 234 GPS ERD EME +A+EL GD F+DYD+EVTKEGEAI+EYLAL+ SA Sbjct: 505 GPSTSTNASERDAEMESELAEELAQGDAFTDYDIEVTKEGEAISEYLALLNSA 557 >ref|XP_002527272.1| conserved hypothetical protein [Ricinus communis] gi|223533365|gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +1 Query: 97 TTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASAQS 240 +TEERDVEMED IA+++ D SDYD++VTKEGEAITEYLAL+ S +S Sbjct: 24 STEERDVEMEDEIAEQIAKADALSDYDIDVTKEGEAITEYLALLDSVRS 72 >ref|XP_006389398.1| hypothetical protein POPTR_0025s00350g [Populus trichocarpa] gi|550312192|gb|ERP48312.1| hypothetical protein POPTR_0025s00350g [Populus trichocarpa] Length = 578 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/53 (69%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVAS 231 EGPS E E+RDVEME IA EL GD SDYD+EV KEGEAI EYLAL+AS Sbjct: 516 EGPSAAEI-EQRDVEMEGEIADELARGDALSDYDIEVAKEGEAINEYLALLAS 567 >ref|XP_007013627.1| Ubiquitin-associated (UBA)/TS-N domain-containing protein [Theobroma cacao] gi|508783990|gb|EOY31246.1| Ubiquitin-associated (UBA)/TS-N domain-containing protein [Theobroma cacao] Length = 464 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASAQS 240 EGPS EERDVEMED IA+E+ D SDYD+E+TKEGEAI EYLAL+AS + Sbjct: 403 EGPSTAGE-EERDVEMEDEIAKEIEIADALSDYDIEITKEGEAINEYLALLASTDN 457 >ref|XP_007201940.1| hypothetical protein PRUPE_ppa004340mg [Prunus persica] gi|462397471|gb|EMJ03139.1| hypothetical protein PRUPE_ppa004340mg [Prunus persica] Length = 515 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/53 (66%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASA 234 GPS +RD EMED +A EL GD SDYDLEVTKEGEAI EYLAL+ SA Sbjct: 461 GPSTAGEVGDRDAEMEDELAGELAQGDALSDYDLEVTKEGEAINEYLALLDSA 513 >ref|XP_001781827.1| predicted protein [Physcomitrella patens] gi|162666734|gb|EDQ53381.1| predicted protein [Physcomitrella patens] Length = 571 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/52 (57%), Positives = 43/52 (82%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELTGDPFSDYDLEVTKEGEAITEYLALVAS 231 E P+ + + RD EME+ IA+E+TGDPF++YD+EV+KEG+AI+EYLAL+ S Sbjct: 514 ESPASTDL-DPRDEEMEEEIAREITGDPFAEYDIEVSKEGDAISEYLALLNS 564 >ref|XP_006852823.1| hypothetical protein AMTR_s00033p00177630 [Amborella trichopoda] gi|548856437|gb|ERN14290.1| hypothetical protein AMTR_s00033p00177630 [Amborella trichopoda] Length = 554 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 109 RDVEMEDAIAQELTGDPFSDYDLEVTKEGEAITEYLALVASAQ 237 RD EME+ + QELT DPF+DYD++VTKEGEA+ EY+AL+ S Q Sbjct: 505 RDNEMEEELVQELTSDPFADYDIDVTKEGEAVAEYVALLNSTQ 547 >ref|XP_004242723.1| PREDICTED: NEDD8 ultimate buster 1-like [Solanum lycopersicum] Length = 570 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALV 225 GPS+ + E RDVEMED I EL GD +SDYD+EVT+EGEAI EYLALV Sbjct: 510 GPSQNKV-ETRDVEMEDEITGELLKGDAYSDYDIEVTEEGEAINEYLALV 558 >ref|XP_006381076.1| ubiquitin-associated domain-containing family protein [Populus trichocarpa] gi|550335581|gb|ERP58873.1| ubiquitin-associated domain-containing family protein [Populus trichocarpa] Length = 585 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVAS 231 EGPS E+RD+EMED IA ELT GD SDY+++VT+EG+AI EYLAL+ S Sbjct: 523 EGPS----AEQRDLEMEDEIADELTRGDALSDYNIDVTQEGDAINEYLALLDS 571 >ref|XP_006381075.1| hypothetical protein POPTR_0006s06020g [Populus trichocarpa] gi|550335580|gb|ERP58872.1| hypothetical protein POPTR_0006s06020g [Populus trichocarpa] Length = 585 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +1 Query: 76 EGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVAS 231 EGPS E+RD+EMED IA ELT GD SDY+++VT+EG+AI EYLAL+ S Sbjct: 523 EGPS----AEQRDLEMEDEIADELTRGDALSDYNIDVTQEGDAINEYLALLDS 571 >ref|XP_006359510.1| PREDICTED: NEDD8 ultimate buster 1-like [Solanum tuberosum] Length = 570 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALV 225 GPS + E RDVEMED I EL GD +SDYD+EVT+EGEAI EYLAL+ Sbjct: 510 GPSHNKV-ETRDVEMEDEITGELLKGDAYSDYDIEVTEEGEAINEYLALI 558 >ref|XP_004488510.1| PREDICTED: NEDD8 ultimate buster 1-like [Cicer arietinum] Length = 557 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/57 (54%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +1 Query: 73 MEGPSEMETTEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASAQS 240 M + + EERDVEMED ++ ++ GD +DYD+EVT EGEAITEYL++V SA S Sbjct: 493 MNEVEDNKKAEERDVEMEDELSADIAKGDALTDYDIEVTIEGEAITEYLSMVESAGS 549 >ref|XP_003546581.1| PREDICTED: uncharacterized protein LOC100804062 [Glycine max] Length = 555 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 100 TEERDVEMEDAIAQELT-GDPFSDYDLEVTKEGEAITEYLALVASAQSK 243 TE+RDVEMED ++ ++ D +DYD+EVT EGEAITEYLALV SA + Sbjct: 500 TEQRDVEMEDELSADIAKADALADYDIEVTVEGEAITEYLALVESASCR 548 >ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fragaria vesca subsp. vesca] Length = 564 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/53 (62%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 82 PSEMETTEERDVEMEDAIAQELTG-DPFSDYDLEVTKEGEAITEYLALVASAQ 237 P ERD EME+ +A+EL D SDYDLEVTKEGEAI EYLAL+ SAQ Sbjct: 512 PGGSSRASERDSEMENELAEELAQQDALSDYDLEVTKEGEAIGEYLALLDSAQ 564 >ref|XP_002960892.1| hypothetical protein SELMODRAFT_73901 [Selaginella moellendorffii] gi|300171831|gb|EFJ38431.1| hypothetical protein SELMODRAFT_73901 [Selaginella moellendorffii] Length = 556 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +1 Query: 85 SEMETTEERDVEMEDAIAQELTGDPFSDYDLEVTKEGEAITEYLALVASAQSK 243 +E + + RDVEMED +A +TGD + +YDLEVT EG AI EYL+LV + S+ Sbjct: 500 AEEDQAQVRDVEMEDEMAGNVTGDAYEEYDLEVTLEGNAIAEYLSLVEGSSSQ 552 >ref|XP_002967121.1| hypothetical protein SELMODRAFT_169084 [Selaginella moellendorffii] gi|300165112|gb|EFJ31720.1| hypothetical protein SELMODRAFT_169084 [Selaginella moellendorffii] Length = 545 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +1 Query: 85 SEMETTEERDVEMEDAIAQELTGDPFSDYDLEVTKEGEAITEYLALVASAQSK 243 +E + + RDVEMED +A +TGD + +YDLEVT EG AI EYL+LV + S+ Sbjct: 489 AEEDQAQVRDVEMEDEMAGNVTGDAYEEYDLEVTLEGNAIAEYLSLVEGSSSQ 541 >ref|XP_004139279.1| PREDICTED: NEDD8 ultimate buster 1-like [Cucumis sativus] Length = 556 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +1 Query: 79 GPSEMETTEERDVEMEDAIAQELTG-DPFSDYDLEVTKEGEAITEYLALVAS 231 GPS E E+RD+EMED +A+EL G SDYD++VTKEGEAITEYL L+ S Sbjct: 500 GPSIGE--EDRDLEMEDELARELNGATAVSDYDMDVTKEGEAITEYLGLLDS 549