BLASTX nr result
ID: Sinomenium22_contig00023098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00023098 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006280850.1| hypothetical protein CARUB_v10026836mg [Caps... 67 3e-09 ref|XP_002320344.2| hypothetical protein POPTR_0014s12420g [Popu... 65 7e-09 ref|XP_002864754.1| brix domain-containing protein [Arabidopsis ... 65 1e-08 ref|XP_006479959.1| PREDICTED: peter Pan-like protein-like isofo... 64 2e-08 ref|XP_006444352.1| hypothetical protein CICLE_v10023300mg, part... 64 2e-08 ref|XP_007200359.1| hypothetical protein PRUPE_ppa008200mg [Prun... 64 2e-08 ref|XP_004156888.1| PREDICTED: LOW QUALITY PROTEIN: capsanthin/c... 64 2e-08 ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucu... 64 2e-08 ref|XP_006394476.1| hypothetical protein EUTSA_v10004503mg [Eutr... 63 4e-08 gb|EXC10297.1| hypothetical protein L484_006192 [Morus notabilis] 63 5e-08 ref|NP_568939.2| Peter Pan-like protein [Arabidopsis thaliana] g... 63 5e-08 ref|NP_851242.1| Peter Pan-like protein [Arabidopsis thaliana] g... 63 5e-08 ref|XP_006347693.1| PREDICTED: peter Pan-like protein-like isofo... 63 5e-08 ref|XP_006846972.1| hypothetical protein AMTR_s00017p00083690 [A... 62 6e-08 ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vin... 62 8e-08 ref|XP_007131633.1| hypothetical protein PHAVU_011G029700g [Phas... 62 1e-07 ref|XP_003540635.1| PREDICTED: peter Pan-like protein-like [Glyc... 62 1e-07 ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communi... 61 1e-07 gb|EYU46667.1| hypothetical protein MIMGU_mgv1a0152911mg, partia... 61 2e-07 ref|XP_002302711.2| hypothetical protein POPTR_0002s20630g [Popu... 61 2e-07 >ref|XP_006280850.1| hypothetical protein CARUB_v10026836mg [Capsella rubella] gi|482549554|gb|EOA13748.1| hypothetical protein CARUB_v10026836mg [Capsella rubella] Length = 306 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYGK 103 AVKLQEIGPRMT+QL+KVEEGLC GGIIFSEYGK Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEYGK 305 >ref|XP_002320344.2| hypothetical protein POPTR_0014s12420g [Populus trichocarpa] gi|550324060|gb|EEE98659.2| hypothetical protein POPTR_0014s12420g [Populus trichocarpa] Length = 322 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQL+K+EEGLC+GG+IFSEYG Sbjct: 261 AVKLQEIGPRMTLQLVKIEEGLCSGGVIFSEYG 293 >ref|XP_002864754.1| brix domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310589|gb|EFH41013.1| brix domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 304 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMT+QL+KVEEGLC GGIIFSEYG Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEYG 304 >ref|XP_006479959.1| PREDICTED: peter Pan-like protein-like isoform X1 [Citrus sinensis] gi|568852600|ref|XP_006479960.1| PREDICTED: peter Pan-like protein-like isoform X2 [Citrus sinensis] Length = 335 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQL+KVEEGLC+G IIFSEYG Sbjct: 271 AVKLQEIGPRMTLQLIKVEEGLCSGSIIFSEYG 303 >ref|XP_006444352.1| hypothetical protein CICLE_v10023300mg, partial [Citrus clementina] gi|557546614|gb|ESR57592.1| hypothetical protein CICLE_v10023300mg, partial [Citrus clementina] Length = 351 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQL+KVEEGLC+G IIFSEYG Sbjct: 287 AVKLQEIGPRMTLQLIKVEEGLCSGSIIFSEYG 319 >ref|XP_007200359.1| hypothetical protein PRUPE_ppa008200mg [Prunus persica] gi|462395759|gb|EMJ01558.1| hypothetical protein PRUPE_ppa008200mg [Prunus persica] Length = 341 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQLMK+EEGLC+GG+IF E+G Sbjct: 270 AVKLQEIGPRMTLQLMKIEEGLCSGGVIFDEFG 302 >ref|XP_004156888.1| PREDICTED: LOW QUALITY PROTEIN: capsanthin/capsorubin synthase, chromoplast-like [Cucumis sativus] Length = 569 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPR+TLQL+KVEEGLC+GGIIF+EYG Sbjct: 496 AVKLQEIGPRLTLQLIKVEEGLCSGGIIFNEYG 528 >ref|XP_004152249.1| PREDICTED: peter Pan-like protein-like [Cucumis sativus] Length = 344 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPR+TLQL+KVEEGLC+GGIIF+EYG Sbjct: 271 AVKLQEIGPRLTLQLIKVEEGLCSGGIIFNEYG 303 >ref|XP_006394476.1| hypothetical protein EUTSA_v10004503mg [Eutrema salsugineum] gi|557091115|gb|ESQ31762.1| hypothetical protein EUTSA_v10004503mg [Eutrema salsugineum] Length = 348 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEY 97 AVKLQEIGPRMT+QL+KVEEGLC+GGIIFSEY Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCSGGIIFSEY 303 >gb|EXC10297.1| hypothetical protein L484_006192 [Morus notabilis] Length = 101 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIG RMTLQL+KVEEGLC+GG+IFSEYG Sbjct: 16 AVKLQEIGARMTLQLIKVEEGLCSGGVIFSEYG 48 >ref|NP_568939.2| Peter Pan-like protein [Arabidopsis thaliana] gi|42573760|ref|NP_974976.1| Peter Pan-like protein [Arabidopsis thaliana] gi|10176870|dbj|BAB10077.1| unnamed protein product [Arabidopsis thaliana] gi|332010132|gb|AED97515.1| Peter Pan-like protein [Arabidopsis thaliana] gi|332010133|gb|AED97516.1| Peter Pan-like protein [Arabidopsis thaliana] Length = 346 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEY 97 AVKLQEIGPRMT+QL+KVEEGLC GGIIFSEY Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEY 303 >ref|NP_851242.1| Peter Pan-like protein [Arabidopsis thaliana] gi|24212091|sp|Q9ASU7.1|PPAN_ARATH RecName: Full=Peter Pan-like protein gi|13605686|gb|AAK32836.1|AF361824_1 AT5g61770/mac9_70 [Arabidopsis thaliana] gi|15810077|gb|AAL06964.1| At1g06730/F4H5_22 [Arabidopsis thaliana] gi|17979000|gb|AAL47460.1| AT5g61770/mac9_70 [Arabidopsis thaliana] gi|332010131|gb|AED97514.1| Peter Pan-like protein [Arabidopsis thaliana] Length = 345 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEY 97 AVKLQEIGPRMT+QL+KVEEGLC GGIIFSEY Sbjct: 272 AVKLQEIGPRMTMQLVKVEEGLCTGGIIFSEY 303 >ref|XP_006347693.1| PREDICTED: peter Pan-like protein-like isoform X1 [Solanum tuberosum] gi|565361908|ref|XP_006347694.1| PREDICTED: peter Pan-like protein-like isoform X2 [Solanum tuberosum] Length = 346 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQL+K+EEGLC GG++F+EYG Sbjct: 270 AVKLQEIGPRMTLQLVKIEEGLCTGGLLFNEYG 302 >ref|XP_006846972.1| hypothetical protein AMTR_s00017p00083690 [Amborella trichopoda] gi|548850001|gb|ERN08553.1| hypothetical protein AMTR_s00017p00083690 [Amborella trichopoda] Length = 383 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEY 97 AVKLQEIGPRMTLQL+K+EEGLC+GGIIF+EY Sbjct: 274 AVKLQEIGPRMTLQLVKIEEGLCSGGIIFNEY 305 >ref|XP_002269158.1| PREDICTED: peter Pan-like protein [Vitis vinifera] gi|297743890|emb|CBI36860.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRMTLQL+K+EEGLC+GG+IF+ YG Sbjct: 270 AVKLQEIGPRMTLQLIKIEEGLCSGGVIFNAYG 302 >ref|XP_007131633.1| hypothetical protein PHAVU_011G029700g [Phaseolus vulgaris] gi|561004633|gb|ESW03627.1| hypothetical protein PHAVU_011G029700g [Phaseolus vulgaris] Length = 343 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYGK 103 AVKLQE+GPRMTLQL+K+E+GLC+G ++FSEYGK Sbjct: 273 AVKLQEVGPRMTLQLVKIEKGLCSGEVLFSEYGK 306 >ref|XP_003540635.1| PREDICTED: peter Pan-like protein-like [Glycine max] Length = 348 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYGK 103 AVKLQE+GPRMTLQL+K+E+GLC+G ++FSEYGK Sbjct: 273 AVKLQEVGPRMTLQLVKIEKGLCSGEVLFSEYGK 306 >ref|XP_002523084.1| Protein Peter pan, putative [Ricinus communis] gi|223537646|gb|EEF39269.1| Protein Peter pan, putative [Ricinus communis] Length = 341 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQE+GPRMTLQL+KVEEGLC+G +IF+EYG Sbjct: 270 AVKLQELGPRMTLQLIKVEEGLCSGALIFNEYG 302 >gb|EYU46667.1| hypothetical protein MIMGU_mgv1a0152911mg, partial [Mimulus guttatus] Length = 96 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYGKF 106 A+KLQEIGPRMTL L+K+EEGLCAG +IFSE+G + Sbjct: 2 AIKLQEIGPRMTLHLIKIEEGLCAGPVIFSEFGNY 36 >ref|XP_002302711.2| hypothetical protein POPTR_0002s20630g [Populus trichocarpa] gi|550345470|gb|EEE81984.2| hypothetical protein POPTR_0002s20630g [Populus trichocarpa] Length = 327 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 2 AVKLQEIGPRMTLQLMKVEEGLCAGGIIFSEYG 100 AVKLQEIGPRM LQL+K+EEGLC+G +IFSEYG Sbjct: 271 AVKLQEIGPRMVLQLVKIEEGLCSGDVIFSEYG 303