BLASTX nr result
ID: Sinomenium22_contig00022993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022993 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034002.1| Cell division control protein 48 C isoform 1... 59 7e-07 emb|CBI27563.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002266185.1| PREDICTED: cell division control protein 48 ... 55 8e-06 >ref|XP_007034002.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|590655493|ref|XP_007034003.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713031|gb|EOY04928.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713032|gb|EOY04929.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 840 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 369 TWTIKEAHFEQALAKVSPSVSDKQKGYYQVLSQSF 265 +WTIK HFE+AL+K+SPSVSDKQK +YQVLS+SF Sbjct: 803 SWTIKTFHFERALSKISPSVSDKQKQFYQVLSESF 837 >emb|CBI27563.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 369 TWTIKEAHFEQALAKVSPSVSDKQKGYYQVLSQSF 265 +WTI HF+QAL K+SPSVS+KQK +YQVLS+SF Sbjct: 732 SWTINAKHFDQALGKISPSVSNKQKHFYQVLSESF 766 >ref|XP_002266185.1| PREDICTED: cell division control protein 48 homolog C-like [Vitis vinifera] Length = 825 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 369 TWTIKEAHFEQALAKVSPSVSDKQKGYYQVLSQSF 265 +WTI HF+QAL K+SPSVS+KQK +YQVLS+SF Sbjct: 788 SWTINAKHFDQALGKISPSVSNKQKHFYQVLSESF 822