BLASTX nr result
ID: Sinomenium22_contig00022992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022992 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034002.1| Cell division control protein 48 C isoform 1... 66 6e-09 ref|XP_007020346.1| Cell division control protein 48 C isoform 2... 60 4e-07 ref|XP_007020345.1| Cell division control protein 48 C isoform 1... 60 4e-07 ref|XP_004156006.1| PREDICTED: LOW QUALITY PROTEIN: cell divisio... 59 7e-07 ref|XP_004146387.1| PREDICTED: cell division control protein 48 ... 59 7e-07 emb|CBI27563.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002266185.1| PREDICTED: cell division control protein 48 ... 56 6e-06 >ref|XP_007034002.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|590655493|ref|XP_007034003.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713031|gb|EOY04928.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713032|gb|EOY04929.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 840 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 497 EKQLLGQGSFDMKTWTIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRAA 345 E++L G D +WTIK HFERAL K+SPSVSDKQK++YQVLS+SF+AA Sbjct: 791 EEKLTSTGISDT-SWTIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 840 >ref|XP_007020346.1| Cell division control protein 48 C isoform 2 [Theobroma cacao] gi|508719974|gb|EOY11871.1| Cell division control protein 48 C isoform 2 [Theobroma cacao] Length = 798 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 452 TIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRAA 345 TIK HFERAL K+SPSVSDKQK++YQVLS+SF+AA Sbjct: 763 TIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 798 >ref|XP_007020345.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508719973|gb|EOY11870.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 835 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 452 TIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRAA 345 TIK HFERAL K+SPSVSDKQK++YQVLS+SF+AA Sbjct: 800 TIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 835 >ref|XP_004156006.1| PREDICTED: LOW QUALITY PROTEIN: cell division control protein 48 homolog C-like [Cucumis sativus] Length = 816 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 500 EEKQLLGQGSFDMKTWTIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRAA 345 EEK L + + + TIK HFER L K+SPSVS+KQK +Y++LS+S +AA Sbjct: 765 EEKLTLDNSNIESASCTIKMVHFERGLTKISPSVSEKQKHFYEILSKSLKAA 816 >ref|XP_004146387.1| PREDICTED: cell division control protein 48 homolog C-like [Cucumis sativus] Length = 816 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 500 EEKQLLGQGSFDMKTWTIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRAA 345 EEK L + + + TIK HFER L K+SPSVS+KQK +Y++LS+S +AA Sbjct: 765 EEKLTLDNSNIESASCTIKMVHFERGLTKISPSVSEKQKHFYEILSKSLKAA 816 >emb|CBI27563.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -3 Query: 458 TWTIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRA 348 +WTI HF++AL K+SPSVS+KQK +YQVLS+SF+A Sbjct: 732 SWTINAKHFDQALGKISPSVSNKQKHFYQVLSESFKA 768 >ref|XP_002266185.1| PREDICTED: cell division control protein 48 homolog C-like [Vitis vinifera] Length = 825 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -3 Query: 458 TWTIKEAHFERALVKVSPSVSDKQKRYYQVLSQSFRA 348 +WTI HF++AL K+SPSVS+KQK +YQVLS+SF+A Sbjct: 788 SWTINAKHFDQALGKISPSVSNKQKHFYQVLSESFKA 824