BLASTX nr result
ID: Sinomenium22_contig00022911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022911 (716 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38759.1| hypothetical protein MIMGU_mgv1a026280mg [Mimulus... 57 6e-06 gb|EPS72056.1| hypothetical protein M569_02696, partial [Genlise... 57 8e-06 >gb|EYU38759.1| hypothetical protein MIMGU_mgv1a026280mg [Mimulus guttatus] Length = 762 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 615 LACFTVGGSIALGDYWEAGTIVFLFTIAEWLQSR 716 L TV GSIAL DYWEAGT+VFLFT+++WL+SR Sbjct: 145 LVLITVAGSIALQDYWEAGTVVFLFTVSQWLESR 178 >gb|EPS72056.1| hypothetical protein M569_02696, partial [Genlisea aurea] Length = 700 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +3 Query: 615 LACFTVGGSIALGDYWEAGTIVFLFTIAEWLQSR 716 L V GS+ALGDYWEA TIVFLFT AEWL+SR Sbjct: 138 LVLIAVSGSVALGDYWEAATIVFLFTTAEWLESR 171