BLASTX nr result
ID: Sinomenium22_contig00022239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022239 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of o... 66 4e-09 ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of o... 66 4e-09 gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha cur... 65 1e-08 gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypiu... 65 1e-08 gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypo... 64 2e-08 gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypo... 64 2e-08 ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-Co... 62 6e-08 gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] 62 6e-08 gb|ABK26424.1| unknown [Picea sitchensis] 61 1e-07 gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] 60 2e-07 ref|XP_007037521.1| Biotin carboxyl carrier protein of acetyl-Co... 60 2e-07 gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia... 60 2e-07 gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] 60 2e-07 gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha... 60 2e-07 ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein o... 60 3e-07 ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein o... 60 3e-07 ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of o... 60 3e-07 ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-Co... 60 3e-07 ref|XP_006482734.1| PREDICTED: biotin carboxyl carrier protein o... 60 4e-07 ref|XP_006482733.1| PREDICTED: biotin carboxyl carrier protein o... 60 4e-07 >ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] gi|508717859|gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEILVEDGK+VSVDMPL +IEP Sbjct: 274 MKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] gi|508717857|gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEILVEDGK+VSVDMPL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] Length = 285 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEIL EDGK+VSVDMPL +IEP Sbjct: 249 MKLMNEIEADQSGTIVEILAEDGKSVSVDMPLFVIEP 285 >gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] Length = 282 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG +VEIL EDGKAVSVDMPL +IEP Sbjct: 246 MKLMNEIEADQSGTMVEILAEDGKAVSVDMPLFVIEP 282 >gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEIL EDGK VSVDMPL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEIL EDGK VSVDMPL +IEP Sbjct: 243 MKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] gi|508711730|gb|EOY03627.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EIL EDGKAVSVDMPLL+I P Sbjct: 252 MKLMNEIEADQSGTISEILAEDGKAVSVDMPLLVIVP 288 >gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] Length = 257 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVEIL +DGK VSVDMPL +IEP Sbjct: 221 MKLMNEIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257 >gb|ABK26424.1| unknown [Picea sitchensis] Length = 309 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE D+SG IVEILVEDGK V+VDMPL +I+P Sbjct: 273 MKLMNEIEADRSGTIVEILVEDGKPVAVDMPLFVIKP 309 >gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EILVEDGK VSVD+PL +I P Sbjct: 216 MKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 252 >ref|XP_007037521.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] gi|508774766|gb|EOY22022.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] Length = 269 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIE 110 MKLMNEIEVDQSG IVEIL EDGK VSVD PL +IE Sbjct: 233 MKLMNEIEVDQSGTIVEILAEDGKPVSVDTPLFVIE 268 >gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa] Length = 283 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG +VEI+ EDGK VSVD PL +IEP Sbjct: 247 MKLMNEIEADQSGTVVEIIAEDGKPVSVDTPLFVIEP 283 >gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EILVEDGK VSVD+PL +I P Sbjct: 234 MKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 270 >gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha curcas] Length = 270 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQ+G I EILVEDGK VSVDMPL +I P Sbjct: 234 MKLMNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 >ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 282 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EILVEDGK VS+D+PL +I P Sbjct: 246 MKLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 282 >ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 311 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EILVEDGK VS+D+PL +I P Sbjct: 275 MKLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 311 >ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] Length = 315 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG IVE L+EDGK VSVD PL +IEP Sbjct: 279 MKLMNEIEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 >ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] gi|355493731|gb|AES74934.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EILVEDGK VSVD+PL +I P Sbjct: 242 MKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIVP 278 >ref|XP_006482734.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X2 [Citrus sinensis] Length = 283 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EIL EDGK+VSVD PLL+I P Sbjct: 247 MKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 283 >ref|XP_006482733.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X1 [Citrus sinensis] Length = 286 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 MKLMNEIEVDQSGKIVEILVEDGKAVSVDMPLLIIEP 113 MKLMNEIE DQSG I EIL EDGK+VSVD PLL+I P Sbjct: 250 MKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286