BLASTX nr result
ID: Sinomenium22_contig00022208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022208 (1170 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [A... 62 4e-07 ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 3... 60 2e-06 ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 3... 60 2e-06 ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Popu... 59 5e-06 >ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda] gi|548851766|gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda] Length = 467 Score = 62.4 bits (150), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 PRWQGPSSYAQLILPQGVVPVPGWNAYTVSL 93 PRWQGPSSYAQLILPQG+VPVPGWN Y+ L Sbjct: 226 PRWQGPSSYAQLILPQGMVPVPGWNTYSGQL 256 >ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma cacao] gi|508717997|gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma cacao] Length = 411 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 PRWQGPSSYAQLILPQGVVPVPGWNAYTVSL 93 PRWQGPSSYA LILPQGVV VPGWNAY+ L Sbjct: 182 PRWQGPSSYAPLILPQGVVSVPGWNAYSGQL 212 >ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma cacao] gi|508717996|gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma cacao] Length = 451 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 PRWQGPSSYAQLILPQGVVPVPGWNAYTVSL 93 PRWQGPSSYA LILPQGVV VPGWNAY+ L Sbjct: 222 PRWQGPSSYAPLILPQGVVSVPGWNAYSGQL 252 >ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa] gi|550325287|gb|ERP53853.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa] Length = 255 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 1 PRWQGPSSYAQLILPQGVVPVPGWNAYTVS 90 PRWQ PSSY LILPQGVV VPGWNAY+VS Sbjct: 216 PRWQAPSSYTPLILPQGVVSVPGWNAYSVS 245