BLASTX nr result
ID: Sinomenium22_contig00022080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022080 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO04121.1| hypothetical protein UCRPA7_404 [Togninia minima ... 59 7e-07 >gb|EOO04121.1| hypothetical protein UCRPA7_404 [Togninia minima UCRPA7] Length = 68 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/68 (50%), Positives = 41/68 (60%) Frame = +1 Query: 61 MSGITDEAAVAEHDLIDRAEKEEAKTHEGQTGSTASTDSQKKTTGQGDLASKAQSVVEQA 240 MSGITDEAAVAEHDLI AE + K Q+ + QKK+ G G+ A K S VE+ Sbjct: 1 MSGITDEAAVAEHDLIQHAEDDLNKAQGNQSNPVSGDPEQKKSYGLGE-APKQTSKVEKV 59 Query: 241 KETLGLKK 264 KE L + K Sbjct: 60 KEALHINK 67