BLASTX nr result
ID: Sinomenium22_contig00022033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00022033 (549 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495046.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ... 56 7e-06 ref|XP_007216343.1| hypothetical protein PRUPE_ppa020225mg [Prun... 55 9e-06 >ref|XP_004495046.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial-like [Cicer arietinum] Length = 476 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 197 GIAPLTLNLNQPDSVFHNGFMPLTASKEMKIR 292 G+APLTLNL PDSVF +GFMPLTASKEM IR Sbjct: 421 GVAPLTLNLTNPDSVFGDGFMPLTASKEMPIR 452 >ref|XP_007216343.1| hypothetical protein PRUPE_ppa020225mg [Prunus persica] gi|462412493|gb|EMJ17542.1| hypothetical protein PRUPE_ppa020225mg [Prunus persica] Length = 462 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 197 GIAPLTLNLNQPDSVFHNGFMPLTASKEMKIRA 295 GIAPLTLNL++PD VF++ FMPLTASKEM IRA Sbjct: 409 GIAPLTLNLSKPDPVFNDAFMPLTASKEMPIRA 441