BLASTX nr result
ID: Sinomenium22_contig00021996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021996 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267318.1| PREDICTED: uncharacterized protein LOC100253... 58 1e-06 emb|CBI17534.3| unnamed protein product [Vitis vinifera] 58 1e-06 ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601... 57 4e-06 ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255... 56 5e-06 ref|XP_003611976.1| Membrane protein-like protein [Medicago trun... 56 5e-06 >ref|XP_002267318.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera] Length = 476 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 355 VWVAFLTVQIIKTYAVTCSVEYWILNMLQV 266 VWVAFL VQI+KTY VTCS+EYW+LN LQV Sbjct: 269 VWVAFLAVQIVKTYTVTCSIEYWVLNCLQV 298 >emb|CBI17534.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 355 VWVAFLTVQIIKTYAVTCSVEYWILNMLQV 266 VWVAFL VQI+KTY VTCS+EYW+LN LQV Sbjct: 274 VWVAFLAVQIVKTYTVTCSIEYWVLNCLQV 303 >ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum] Length = 476 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 355 VWVAFLTVQIIKTYAVTCSVEYWILNMLQV 266 VWVAFL +QI+KTY VTCS+ YWILN+LQV Sbjct: 269 VWVAFLAIQIVKTYTVTCSIGYWILNLLQV 298 >ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum] Length = 486 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 355 VWVAFLTVQIIKTYAVTCSVEYWILNMLQV 266 VWVAFL +Q++KTY VTCS+ YWILN+LQV Sbjct: 279 VWVAFLAIQVVKTYTVTCSIGYWILNLLQV 308 >ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula] gi|358344383|ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula] gi|355502204|gb|AES83407.1| Membrane protein-like protein [Medicago truncatula] gi|355513311|gb|AES94934.1| Membrane protein-like protein [Medicago truncatula] Length = 470 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 355 VWVAFLTVQIIKTYAVTCSVEYWILNMLQV 266 VWVAFL VQI+KTY TCS+EYWILN LQV Sbjct: 264 VWVAFLIVQIVKTYTKTCSIEYWILNFLQV 293