BLASTX nr result
ID: Sinomenium22_contig00021741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021741 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40375.1| hypothetical protein DOTSEDRAFT_56583 [Dothistrom... 83 4e-14 >gb|EME40375.1| hypothetical protein DOTSEDRAFT_56583 [Dothistroma septosporum NZE10] Length = 191 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = +2 Query: 2 KILEEAHANKDNPEHPAHKDHPKHGEFLKSIPSRLXXXXXXXXXXXXXSDLVNGLI 169 KILEEAH NKDNPEHPAHKDHPKHGEFLKSIP RL +DLVNG++ Sbjct: 134 KILEEAHKNKDNPEHPAHKDHPKHGEFLKSIPKRLGGAAIFGAGATAGADLVNGML 189