BLASTX nr result
ID: Sinomenium22_contig00021621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021621 (1120 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369977.1| hypothetical protein POPTR_0001s36760g [Popu... 62 6e-07 ref|XP_006370060.1| hypothetical protein POPTR_0001s39120g [Popu... 61 7e-07 ref|XP_006383274.1| hypothetical protein POPTR_0005s13270g [Popu... 61 7e-07 ref|XP_006376750.1| hypothetical protein POPTR_0012s05700g [Popu... 61 7e-07 ref|XP_006371195.1| hypothetical protein POPTR_0019s05465g [Popu... 61 7e-07 ref|XP_006380624.1| hypothetical protein POPTR_0007s09915g [Popu... 59 5e-06 ref|XP_006380153.1| hypothetical protein POPTR_0008s22405g [Popu... 59 5e-06 >ref|XP_006369977.1| hypothetical protein POPTR_0001s36760g [Populus trichocarpa] gi|550349044|gb|ERP66546.1| hypothetical protein POPTR_0001s36760g [Populus trichocarpa] Length = 662 Score = 61.6 bits (148), Expect = 6e-07 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -2 Query: 1098 LTFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSILLSSHE 931 L EDWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S L S + Sbjct: 379 LALEDWEKARFFVKFLKLFYTITLKFSGSLYVTSNSFFHELISMHTSISQLCRSED 434 >ref|XP_006370060.1| hypothetical protein POPTR_0001s39120g [Populus trichocarpa] gi|550349236|gb|ERP66629.1| hypothetical protein POPTR_0001s39120g [Populus trichocarpa] Length = 660 Score = 61.2 bits (147), Expect = 7e-07 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -2 Query: 1119 SEDKKKIL---TFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSI 949 S+ K+K L EDWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S Sbjct: 368 SQGKQKNLGPPALEDWEKARSFVKFLKLFYTVTLKFSGSLYVTSNSFFNELISMHTSISQ 427 Query: 948 LLSSHE 931 L S + Sbjct: 428 LCRSED 433 >ref|XP_006383274.1| hypothetical protein POPTR_0005s13270g [Populus trichocarpa] gi|550338857|gb|ERP61071.1| hypothetical protein POPTR_0005s13270g [Populus trichocarpa] Length = 347 Score = 61.2 bits (147), Expect = 7e-07 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -2 Query: 1119 SEDKKKIL---TFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSI 949 S+ K+K L EDWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S Sbjct: 18 SQGKQKNLGPPALEDWEKTRSFVKFLKLFYTVTLKFSGSLYVTSNSFFHELISMHTSISQ 77 Query: 948 LLSSHE 931 L S + Sbjct: 78 LCRSED 83 >ref|XP_006376750.1| hypothetical protein POPTR_0012s05700g [Populus trichocarpa] gi|550326455|gb|ERP54547.1| hypothetical protein POPTR_0012s05700g [Populus trichocarpa] Length = 732 Score = 61.2 bits (147), Expect = 7e-07 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -2 Query: 1119 SEDKKKIL---TFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSI 949 S+ K+K L EDWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S Sbjct: 409 SQGKQKNLGPPALEDWEKARSFVKFLKLFYTVTLKFSGSLYVTSNSFFHELISMHTSISQ 468 Query: 948 LLSSHE 931 L S + Sbjct: 469 LCRSED 474 >ref|XP_006371195.1| hypothetical protein POPTR_0019s05465g [Populus trichocarpa] gi|550316867|gb|ERP48992.1| hypothetical protein POPTR_0019s05465g [Populus trichocarpa] Length = 330 Score = 61.2 bits (147), Expect = 7e-07 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -2 Query: 1119 SEDKKKIL---TFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSI 949 S+ K+K L EDWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S Sbjct: 30 SQGKQKNLGPPALEDWEKARSFVKFLKLFYTVTLKFSGSLYVTSNSFFHELISMHTSISQ 89 Query: 948 LLSSHE 931 L S + Sbjct: 90 LCRSED 95 >ref|XP_006380624.1| hypothetical protein POPTR_0007s09915g [Populus trichocarpa] gi|550334514|gb|ERP58421.1| hypothetical protein POPTR_0007s09915g [Populus trichocarpa] Length = 246 Score = 58.5 bits (140), Expect = 5e-06 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = -2 Query: 1098 LTFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSILLSSHE 931 L EDWE +R F +FLK+FY TLK GSL+V+ N FF EL+S+ +S L S + Sbjct: 184 LILEDWEKARSFVKFLKLFYMVTLKFFGSLYVTSNSFFHELISMHKSISQLCRSED 239 >ref|XP_006380153.1| hypothetical protein POPTR_0008s22405g [Populus trichocarpa] gi|550333674|gb|ERP57950.1| hypothetical protein POPTR_0008s22405g [Populus trichocarpa] Length = 342 Score = 58.5 bits (140), Expect = 5e-06 Identities = 28/59 (47%), Positives = 40/59 (67%) Frame = -2 Query: 1107 KKILTFEDWEISRVFARFLKVFYEATLKMSGSLFVS*NKFFQELVSIQGRVSILLSSHE 931 +K+ +DWE +R F +FLK+FY TLK SGSL+V+ N FF EL+S+ +S L S + Sbjct: 50 EKLKIEKDWEKARFFMKFLKLFYMVTLKFSGSLYVTSNSFFHELISMHTSISQLCRSKD 108