BLASTX nr result
ID: Sinomenium22_contig00021576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021576 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320319.2| hypothetical protein POPTR_0014s11930g [Popu... 58 1e-06 ref|XP_003632400.1| PREDICTED: uncharacterized protein LOC100854... 56 5e-06 emb|CBI36917.3| unnamed protein product [Vitis vinifera] 56 5e-06 >ref|XP_002320319.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa] gi|550324029|gb|EEE98634.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa] Length = 411 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/51 (50%), Positives = 35/51 (68%) Frame = -3 Query: 461 LIFSDRGHLPRRSFKDWVLLVLSHIMYSISVFLTFLASVFSKLGQIDNLKH 309 L+ SDRGH P+++ +DW L VLS +M + +FLA + SKLGQ D LKH Sbjct: 361 LLISDRGHSPKKNLQDWALFVLSWLMCFMGALFSFLADLCSKLGQRDRLKH 411 >ref|XP_003632400.1| PREDICTED: uncharacterized protein LOC100854991 [Vitis vinifera] Length = 379 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -3 Query: 461 LIFSDRGHLPRRSFKDWVLLVLSHIMYSISVFLTFLASVFSKLGQ 327 L+ SDRGH+P+RS DW LL L+ +M ++ F FLA FSKLGQ Sbjct: 330 LLISDRGHIPKRSILDWTLLALALLMCYLAAFFEFLAEFFSKLGQ 374 >emb|CBI36917.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -3 Query: 461 LIFSDRGHLPRRSFKDWVLLVLSHIMYSISVFLTFLASVFSKLGQ 327 L+ SDRGH+P+RS DW LL L+ +M ++ F FLA FSKLGQ Sbjct: 238 LLISDRGHIPKRSILDWTLLALALLMCYLAAFFEFLAEFFSKLGQ 282