BLASTX nr result
ID: Sinomenium22_contig00021342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021342 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051717.1| Uncharacterized protein isoform 1 [Theobroma... 62 8e-08 gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] 57 3e-06 >ref|XP_007051717.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590721800|ref|XP_007051718.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508703978|gb|EOX95874.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508703979|gb|EOX95875.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1079 Score = 62.0 bits (149), Expect = 8e-08 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 6/121 (4%) Frame = +2 Query: 2 SNKLERQRLRLNASHSGGGGLDLNSVDGIEDKA-DGAXXXXXXXXXXXXSVADTVVPRHS 178 S+ +E L N + S L L + G + DG+ +V+D V ++ Sbjct: 758 SDGIEEHLLGYNDARSAMDSLHLRAELGSKLSGFDGSTEIRLPEEDSLIAVSDPVKLQNF 817 Query: 179 IAMPAENVINADLLSSSGVPIDIADKLAALNSVLKNERSI----EGPPFLSGPHHV-EPN 343 MPA N + +LL S PID+A+KLAAL +VL++ER I EGPPFL GP+ + EP+ Sbjct: 818 --MPARNSVKVELLPSQETPIDVAEKLAALKAVLRDERPIIGGQEGPPFLPGPYDIREPD 875 Query: 344 V 346 + Sbjct: 876 I 876 >gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] Length = 1056 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/51 (52%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +2 Query: 185 MPAENVINADLLSSSGVPIDIADKLAALNSVLKNERSIEG---PPFLSGPH 328 MP +++ ++LLSSS VP+D A+KLA NS ++ERSI G PPFL GP+ Sbjct: 813 MPPGSMVKSELLSSSNVPVDYAEKLATFNSAFRDERSIRGGQEPPFLRGPY 863