BLASTX nr result
ID: Sinomenium22_contig00021107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00021107 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [S... 81 2e-13 ref|XP_004250423.1| PREDICTED: 40S ribosomal protein S29-like [S... 81 2e-13 ref|XP_007042613.1| Ribosomal protein S14p/S29e family protein [... 81 2e-13 ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [C... 80 2e-13 gb|ABK93131.1| unknown [Populus trichocarpa] 79 5e-13 gb|ABK93425.1| unknown [Populus trichocarpa] 79 5e-13 gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] 79 9e-13 ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29-like [C... 79 9e-13 gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] 79 9e-13 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [V... 79 9e-13 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 79 9e-13 gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] 79 9e-13 gb|EYU25839.1| hypothetical protein MIMGU_mgv1a017601mg [Mimulus... 77 2e-12 ref|NP_001066851.1| Os12g0508300 [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Popu... 76 4e-12 ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prun... 76 4e-12 ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Popu... 75 9e-12 tpg|DAA51657.1| TPA: 40S ribosomal protein S29, partial [Zea mays] 75 9e-12 gb|AFW74669.1| hypothetical protein ZEAMMB73_738396 [Zea mays] 75 9e-12 ref|NP_001152431.1| LOC100286071 [Zea mays] gi|195656233|gb|ACG4... 75 9e-12 >ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|565367342|ref|XP_006350329.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] Length = 56 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_004250423.1| PREDICTED: 40S ribosomal protein S29-like [Solanum lycopersicum] Length = 56 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_007042613.1| Ribosomal protein S14p/S29e family protein [Theobroma cacao] gi|388494112|gb|AFK35122.1| unknown [Lotus japonicus] gi|508706548|gb|EOX98444.1| Ribosomal protein S14p/S29e family protein [Theobroma cacao] Length = 56 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] gi|568867204|ref|XP_006486933.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] Length = 56 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGF+KYR Sbjct: 22 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 56 >gb|ABK93131.1| unknown [Populus trichocarpa] Length = 56 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|ABK93425.1| unknown [Populus trichocarpa] Length = 56 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] Length = 82 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 48 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 82 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29-like [Cicer arietinum] gi|502158873|ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29-like [Cicer arietinum] Length = 56 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|470106904|ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29-like [Fragaria vesca subsp. vesca] gi|470109340|ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29-like [Fragaria vesca subsp. vesca] gi|593640056|ref|XP_007143103.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] gi|561016293|gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] Length = 56 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449484349|ref|XP_004156858.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449508184|ref|XP_004163243.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449520128|ref|XP_004167086.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] Length = 56 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] Length = 73 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 39 RVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 73 >gb|EYU25839.1| hypothetical protein MIMGU_mgv1a017601mg [Mimulus guttatus] Length = 56 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSN+KEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNSKEIGFIKYR 56 >ref|NP_001066851.1| Os12g0508300 [Oryza sativa Japonica Group] gi|297722587|ref|NP_001173657.1| Os03g0773150 [Oryza sativa Japonica Group] gi|31745220|gb|AAP68880.1| putative ribosomal protein S29 [Oryza sativa Japonica Group] gi|77552059|gb|ABA94856.1| 40S ribosomal protein S29, putative, expressed [Oryza sativa Japonica Group] gi|113649358|dbj|BAF29870.1| Os12g0508300 [Oryza sativa Japonica Group] gi|125535057|gb|EAY81605.1| hypothetical protein OsI_36775 [Oryza sativa Indica Group] gi|125577778|gb|EAZ19000.1| hypothetical protein OsJ_34533 [Oryza sativa Japonica Group] gi|149391293|gb|ABR25664.1| 40S ribosomal protein S29 [Oryza sativa Indica Group] gi|255674934|dbj|BAH92385.1| Os03g0773150 [Oryza sativa Japonica Group] Length = 56 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 22 RVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 56 >ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] gi|550323136|gb|EEE99013.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] Length = 90 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIK R Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKVR 56 >ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] gi|462420492|gb|EMJ24755.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] Length = 56 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH +IRKY LMCCRQCFRSNAKEIGFIKYR Sbjct: 22 RVCGNPHGLIRKYALMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] gi|550348537|gb|EEE83573.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] Length = 80 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVCGNPH IIRKYGLMCCRQCFRSNAKEIGFIK + Sbjct: 22 RVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKLK 56 >tpg|DAA51657.1| TPA: 40S ribosomal protein S29, partial [Zea mays] Length = 89 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVC NPH +IRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 55 RVCANPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 89 >gb|AFW74669.1| hypothetical protein ZEAMMB73_738396 [Zea mays] Length = 52 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVC NPH +IRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 18 RVCANPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 52 >ref|NP_001152431.1| LOC100286071 [Zea mays] gi|195656233|gb|ACG47584.1| 40S ribosomal protein S29 [Zea mays] Length = 56 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 RVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 107 RVC NPH +IRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 22 RVCANPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 56