BLASTX nr result
ID: Sinomenium22_contig00020806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020806 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = -3 Query: 184 QHRLVILPLSRTGGGRCSVKPASRGALPSRIRVAPAFAGATRFKLSTWIGQASEELYE 11 +H+LVILPL R GG RCSVKPASR AL SR +V PAFA +LS W G+A + ++ Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQ 73 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = +2 Query: 74 EGWGDSNPRGEGTA*GWFHRAATTSRSRQWKDYEPVLYGS 193 EG G PR EGTA GWFHRAA TS S QWKD PVL G+ Sbjct: 18 EGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLPGA 57