BLASTX nr result
ID: Sinomenium22_contig00020741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020741 (1786 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632228.1| PREDICTED: calmodulin-related protein isofor... 59 9e-06 >ref|XP_003632228.1| PREDICTED: calmodulin-related protein isoform 2 [Vitis vinifera] Length = 166 Score = 58.5 bits (140), Expect = 9e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 NLASGCITTKELGTVMRSLGQNPTEAELQD 2 N +GCITTKELGTVMRSLGQNPTEAELQD Sbjct: 39 NCTAGCITTKELGTVMRSLGQNPTEAELQD 68