BLASTX nr result
ID: Sinomenium22_contig00020638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020638 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF76219.1| hypothetical protein EPUS_04296 [Endocarpon pusil... 136 3e-30 gb|EXJ60436.1| aquaglyceroporin like protein, other eukaryote [C... 131 1e-28 gb|ETI24730.1| hypothetical protein G647_04100 [Cladophialophora... 129 3e-28 gb|ETN43412.1| hypothetical protein HMPREF1541_02571 [Cyphelloph... 129 5e-28 gb|EGY16575.1| aquaporin-3 [Verticillium dahliae VdLs.17] 129 5e-28 ref|XP_003004692.1| aquaporin-3 [Verticillium alfalfae VaMs.102]... 129 5e-28 gb|EHY61025.1| aquaglyceroporin like protein [Exophiala dermatit... 128 7e-28 gb|EXJ75752.1| aquaglyceroporin like protein, other eukaryote [C... 128 9e-28 gb|EHY54199.1| aquaglyceroporin like protein [Exophiala dermatit... 128 9e-28 ref|XP_003172410.1| aquaporin-3 [Arthroderma gypseum CBS 118893]... 128 9e-28 gb|EXJ69309.1| aquaglyceroporin like protein, other eukaryote [C... 127 1e-27 gb|EZF30634.1| hypothetical protein H101_05735 [Trichophyton int... 127 2e-27 gb|ETI20423.1| hypothetical protein G647_08458 [Cladophialophora... 127 2e-27 gb|EGD95973.1| aquaglyceroporin [Trichophyton tonsurans CBS 1128... 127 2e-27 gb|EXJ94010.1| aquaglyceroporin like protein, other eukaryote [C... 126 3e-27 gb|EXJ82684.1| aquaglyceroporin like protein, other eukaryote [C... 126 4e-27 gb|EXJ54486.1| aquaglyceroporin like protein, other eukaryote [C... 125 5e-27 gb|EON69784.1| hypothetical protein W97_09047 [Coniosporium apol... 125 6e-27 gb|EXJ90775.1| aquaglyceroporin like protein, other eukaryote [C... 125 8e-27 ref|XP_003237178.1| aquaglyceroporin [Trichophyton rubrum CBS 11... 124 2e-26 >gb|ERF76219.1| hypothetical protein EPUS_04296 [Endocarpon pusillum Z07020] Length = 304 Score = 136 bits (342), Expect = 3e-30 Identities = 55/76 (72%), Positives = 62/76 (81%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYGHEVWSAG YYFW+PMVAPFFGC FGGW YDMF+FTG +PINTP +GL RL++P Sbjct: 229 YFLGYGHEVWSAGGYYFWVPMVAPFFGCAFGGWLYDMFLFTGVSPINTPYVGLQRLVRPR 288 Query: 194 RETWSNTYKREHPEAV 147 R WSNTY+ H V Sbjct: 289 RSVWSNTYQDRHSGVV 304 >gb|EXJ60436.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora yegresii CBS 114405] Length = 353 Score = 131 bits (329), Expect = 1e-28 Identities = 53/68 (77%), Positives = 59/68 (86%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYG VW+AG +YFWIPMVAPFFGCTFGGW YDMF+FTGE+PINTP +GL R +KPN Sbjct: 278 YMLGYGPHVWTAGGHYFWIPMVAPFFGCTFGGWLYDMFLFTGESPINTPVVGLMRFLKPN 337 Query: 194 RETWSNTY 171 R TWSNTY Sbjct: 338 RSTWSNTY 345 >gb|ETI24730.1| hypothetical protein G647_04100 [Cladophialophora carrionii CBS 160.54] Length = 353 Score = 129 bits (325), Expect = 3e-28 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYG VW+AG +YFW+PMV+PFFGCTFGGW YDMF+FTGE+PINTP +GL R +KPN Sbjct: 278 YMLGYGPHVWTAGGHYFWVPMVSPFFGCTFGGWLYDMFLFTGESPINTPVVGLMRFLKPN 337 Query: 194 RETWSNTY 171 R TWSNTY Sbjct: 338 RSTWSNTY 345 >gb|ETN43412.1| hypothetical protein HMPREF1541_02571 [Cyphellophora europaea CBS 101466] Length = 346 Score = 129 bits (323), Expect = 5e-28 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYGHEVWSAG YYFWIPMVAPFFGCTFGGW YD+F+FTG++PINTP +GL R I+P Sbjct: 274 YMLGYGHEVWSAGGYYFWIPMVAPFFGCTFGGWLYDVFLFTGDSPINTPWMGLKRFIRPT 333 Query: 194 RETWSNT 174 R+ WSNT Sbjct: 334 RDVWSNT 340 >gb|EGY16575.1| aquaporin-3 [Verticillium dahliae VdLs.17] Length = 315 Score = 129 bits (323), Expect = 5e-28 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYGHEVWSAGNYYFWIPMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R KP Sbjct: 241 YILGYGHEVWSAGNYYFWIPMVAPFFGCAFGGFLYDVFIYTGESPINTPYMGLQRFFKPK 300 Query: 194 RETWSNTYK 168 R WSNTYK Sbjct: 301 RSVWSNTYK 309 >ref|XP_003004692.1| aquaporin-3 [Verticillium alfalfae VaMs.102] gi|261357268|gb|EEY19696.1| aquaporin-3 [Verticillium alfalfae VaMs.102] Length = 315 Score = 129 bits (323), Expect = 5e-28 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYGHEVWSAGNYYFWIPMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R KP Sbjct: 241 YILGYGHEVWSAGNYYFWIPMVAPFFGCAFGGFLYDVFIYTGESPINTPYMGLQRFFKPK 300 Query: 194 RETWSNTYK 168 R WSNTYK Sbjct: 301 RSVWSNTYK 309 >gb|EHY61025.1| aquaglyceroporin like protein [Exophiala dermatitidis NIH/UT8656] Length = 338 Score = 128 bits (322), Expect = 7e-28 Identities = 50/72 (69%), Positives = 60/72 (83%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGHEVWSAG YYFW+PMVAPF GCTFGGW YD+F+FTGE+PINTP +GL R +KP Sbjct: 265 YMIGYGHEVWSAGGYYFWVPMVAPFCGCTFGGWLYDVFLFTGESPINTPYMGLARFLKPK 324 Query: 194 RETWSNTYKREH 159 + WSNTY ++ Sbjct: 325 KSVWSNTYSADN 336 >gb|EXJ75752.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora psammophila CBS 110553] Length = 379 Score = 128 bits (321), Expect = 9e-28 Identities = 51/68 (75%), Positives = 58/68 (85%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYG VW+AG+YYFW+PMVAPFFGCTFGGW YDMF+FTGE+P+NTP GL R +KP Sbjct: 304 YMLGYGPHVWTAGDYYFWVPMVAPFFGCTFGGWLYDMFLFTGESPVNTPYAGLARFLKPT 363 Query: 194 RETWSNTY 171 R TWSNTY Sbjct: 364 RATWSNTY 371 >gb|EHY54199.1| aquaglyceroporin like protein [Exophiala dermatitidis NIH/UT8656] Length = 349 Score = 128 bits (321), Expect = 9e-28 Identities = 52/68 (76%), Positives = 59/68 (86%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYGH VWSAGNYYFW+PMVAPF GCTFGGW YDMF++TGE+PINT +GL RL+K N Sbjct: 278 YMLGYGHHVWSAGNYYFWVPMVAPFCGCTFGGWLYDMFLYTGESPINTEYMGLARLVKWN 337 Query: 194 RETWSNTY 171 + TWSNTY Sbjct: 338 KRTWSNTY 345 >ref|XP_003172410.1| aquaporin-3 [Arthroderma gypseum CBS 118893] gi|311342796|gb|EFR01999.1| aquaporin-3 [Arthroderma gypseum CBS 118893] Length = 371 Score = 128 bits (321), Expect = 9e-28 Identities = 52/67 (77%), Positives = 60/67 (89%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYGHEVWSAG YYFW+PMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R I+PN Sbjct: 298 YFLGYGHEVWSAGGYYFWVPMVAPFFGCLFGGFLYDVFLYTGESPINTPWMGLDRFIRPN 357 Query: 194 RETWSNT 174 RE WSNT Sbjct: 358 REVWSNT 364 >gb|EXJ69309.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora psammophila CBS 110553] Length = 338 Score = 127 bits (320), Expect = 1e-27 Identities = 51/69 (73%), Positives = 58/69 (84%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGH VWSAG YYFW+PMVAPF GC FGGW YDMF+FTGE+PINTP +GL RL++P Sbjct: 265 YMIGYGHGVWSAGGYYFWVPMVAPFCGCAFGGWLYDMFLFTGESPINTPYMGLKRLVQPK 324 Query: 194 RETWSNTYK 168 R WSNTYK Sbjct: 325 RSVWSNTYK 333 >gb|EZF30634.1| hypothetical protein H101_05735 [Trichophyton interdigitale H6] Length = 369 Score = 127 bits (318), Expect = 2e-27 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYGHEVWSAG YYFW+PMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R I+PN Sbjct: 296 YFLGYGHEVWSAGGYYFWVPMVAPFFGCLFGGFLYDVFLYTGESPINTPWMGLDRFIRPN 355 Query: 194 RETWSNT 174 R+ WSNT Sbjct: 356 RDVWSNT 362 >gb|ETI20423.1| hypothetical protein G647_08458 [Cladophialophora carrionii CBS 160.54] Length = 357 Score = 127 bits (318), Expect = 2e-27 Identities = 51/71 (71%), Positives = 59/71 (83%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGHEVWSAG YYFW+PMVAPF GCTFGG+ YD F+FTGE+PINTP +GL RL++P Sbjct: 284 YMIGYGHEVWSAGGYYFWVPMVAPFLGCTFGGFLYDTFLFTGESPINTPYLGLQRLVQPK 343 Query: 194 RETWSNTYKRE 162 R WSNTY E Sbjct: 344 RSVWSNTYNAE 354 >gb|EGD95973.1| aquaglyceroporin [Trichophyton tonsurans CBS 112818] gi|326477169|gb|EGE01179.1| aquaporin-3 [Trichophyton equinum CBS 127.97] Length = 369 Score = 127 bits (318), Expect = 2e-27 Identities = 51/67 (76%), Positives = 60/67 (89%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYGHEVWSAG YYFW+PMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R I+PN Sbjct: 296 YFLGYGHEVWSAGGYYFWVPMVAPFFGCLFGGFLYDVFLYTGESPINTPWMGLDRFIRPN 355 Query: 194 RETWSNT 174 R+ WSNT Sbjct: 356 RDVWSNT 362 >gb|EXJ94010.1| aquaglyceroporin like protein, other eukaryote [Capronia coronata CBS 617.96] Length = 363 Score = 126 bits (317), Expect = 3e-27 Identities = 51/71 (71%), Positives = 61/71 (85%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y LGYG VW+AG+YYFW+PMVAPFFGCTFGGW YDMF+FTGE+PINT +GL RL+K N Sbjct: 292 YMLGYGPHVWTAGDYYFWVPMVAPFFGCTFGGWLYDMFLFTGESPINTECVGLARLLKWN 351 Query: 194 RETWSNTYKRE 162 ++TWSNT+ E Sbjct: 352 KKTWSNTHNSE 362 >gb|EXJ82684.1| aquaglyceroporin like protein, other eukaryote [Capronia epimyces CBS 606.96] Length = 337 Score = 126 bits (316), Expect = 4e-27 Identities = 50/68 (73%), Positives = 56/68 (82%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGHEVWSAG YYFW+PMVAPF GC FGGW YDMF+FTGE+PINTP +GL R +P Sbjct: 265 YMIGYGHEVWSAGGYYFWVPMVAPFCGCAFGGWLYDMFLFTGESPINTPYLGLQRFFQPK 324 Query: 194 RETWSNTY 171 R WSNTY Sbjct: 325 RSVWSNTY 332 >gb|EXJ54486.1| aquaglyceroporin like protein, other eukaryote [Cladophialophora yegresii CBS 114405] Length = 338 Score = 125 bits (315), Expect = 5e-27 Identities = 51/71 (71%), Positives = 59/71 (83%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGHEVWSAG YYFW+PMVAPF GCTFGG+ YD F+FTGE+PINTP +GL RL++P Sbjct: 265 YMIGYGHEVWSAGGYYFWVPMVAPFCGCTFGGFLYDTFLFTGESPINTPYMGLQRLVQPK 324 Query: 194 RETWSNTYKRE 162 R WSNTY E Sbjct: 325 RSVWSNTYNSE 335 >gb|EON69784.1| hypothetical protein W97_09047 [Coniosporium apollinis CBS 100218] Length = 351 Score = 125 bits (314), Expect = 6e-27 Identities = 51/66 (77%), Positives = 58/66 (87%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYGHEVWSAGNYYFW+PMVAPFFGCTFGGW YD+FMFTGE+P+NTP +GL RL +P+ Sbjct: 283 YFLGYGHEVWSAGNYYFWVPMVAPFFGCTFGGWMYDVFMFTGESPVNTPWLGLKRLFRPS 342 Query: 194 RETWSN 177 R N Sbjct: 343 RTKTPN 348 >gb|EXJ90775.1| aquaglyceroporin like protein, other eukaryote [Capronia coronata CBS 617.96] Length = 338 Score = 125 bits (313), Expect = 8e-27 Identities = 51/71 (71%), Positives = 57/71 (80%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 Y +GYGHEVWSAG YYFWIPMVAPF G TFGGW YDMF+FTGE+PINTP +GL R +P Sbjct: 265 YMIGYGHEVWSAGGYYFWIPMVAPFCGATFGGWLYDMFLFTGESPINTPYMGLKRFFEPK 324 Query: 194 RETWSNTYKRE 162 R WSNTY + Sbjct: 325 RSVWSNTYNAD 335 >ref|XP_003237178.1| aquaglyceroporin [Trichophyton rubrum CBS 118892] gi|326460176|gb|EGD85629.1| aquaglyceroporin [Trichophyton rubrum CBS 118892] gi|607867433|gb|EZF12738.1| hypothetical protein H100_06558 [Trichophyton rubrum MR850] gi|607901563|gb|EZF39185.1| hypothetical protein H102_06524 [Trichophyton rubrum CBS 100081] gi|607913890|gb|EZF50019.1| hypothetical protein H103_06550 [Trichophyton rubrum CBS 288.86] gi|607925909|gb|EZF60604.1| hypothetical protein H104_06532 [Trichophyton rubrum CBS 289.86] gi|607949846|gb|EZF81883.1| hypothetical protein H110_06545 [Trichophyton rubrum MR1448] gi|607961974|gb|EZF92545.1| hypothetical protein H113_06595 [Trichophyton rubrum MR1459] gi|607974469|gb|EZG03730.1| hypothetical protein H106_06391 [Trichophyton rubrum CBS 735.88] gi|607986019|gb|EZG14155.1| hypothetical protein H107_06696 [Trichophyton rubrum CBS 202.88] Length = 369 Score = 124 bits (310), Expect = 2e-26 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = -3 Query: 374 YFLGYGHEVWSAGNYYFWIPMVAPFFGCTFGGWCYDMFMFTGETPINTPAIGLTRLIKPN 195 YFLGYG EVWSAG YYFW+PMVAPFFGC FGG+ YD+F++TGE+PINTP +GL R I+PN Sbjct: 296 YFLGYGREVWSAGGYYFWVPMVAPFFGCLFGGFLYDVFLYTGESPINTPWMGLDRFIRPN 355 Query: 194 RETWSNT 174 R+ WSNT Sbjct: 356 RDVWSNT 362