BLASTX nr result
ID: Sinomenium22_contig00020622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020622 (1021 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK71799.1| hypothetical chloroplast RF2 [Erythrospermum phyt... 66 3e-08 gb|AEQ36981.1| hypothetical chloroplast RF2 (chloroplast) [Datur... 62 4e-07 ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis ... 62 5e-07 gb|AEX93989.1| hypothetical chloroplast RF21 (chloroplast) [Trit... 61 6e-07 ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica... 61 8e-07 gb|AFU96444.1| Ycf2, partial (chloroplast) [Caloncoba echinata] 60 1e-06 ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_53... 60 1e-06 ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) ... 60 1e-06 ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) ... 60 1e-06 ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) ... 60 1e-06 ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) ... 60 1e-06 ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) ... 60 1e-06 ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi... 60 1e-06 ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|... 60 1e-06 ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|39... 60 1e-06 ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridi... 60 1e-06 gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317... 60 1e-06 ref|YP_006303533.1| Ycf2 (chloroplast) [Gossypium gossypioides] ... 60 1e-06 ref|YP_005088322.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi... 60 1e-06 ref|YP_005087735.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|... 60 1e-06 >gb|AEK71799.1| hypothetical chloroplast RF2 [Erythrospermum phytolaccoides] Length = 2302 Score = 65.9 bits (159), Expect = 3e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQL S MNPSD EGKNLH YLNFNSN+GLIHT CS K Sbjct: 1171 CQLLSDMNPSDSEGKNLHQYLNFNSNMGLIHTPCSEK 1207 >gb|AEQ36981.1| hypothetical chloroplast RF2 (chloroplast) [Datura stramonium] Length = 2267 Score = 62.0 bits (149), Expect = 4e-07 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAKKKSGIINQK 669 CQ S MN SD EGKNLH YLNFNSN+GLIHT CS K S + +K Sbjct: 1143 CQPLSDMNLSDSEGKNLHQYLNFNSNMGLIHTPCSEKDLSSVKRKK 1188 >ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|229577815|ref|YP_002836151.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933926|gb|ACO92059.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933943|gb|ACO92076.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] Length = 2288 Score = 61.6 bits (148), Expect = 5e-07 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD EGKNLH Y NFNSN+GLIHT CS K Sbjct: 1149 CQPLSDMNPSDSEGKNLHQYFNFNSNMGLIHTPCSEK 1185 >gb|AEX93989.1| hypothetical chloroplast RF21 (chloroplast) [Triteleia hyacinthina] Length = 2276 Score = 61.2 bits (147), Expect = 6e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ PS MN SD EGKNLH YL+FNSN+GLIHT CS K Sbjct: 1152 CQPPSDMNLSDSEGKNLHQYLSFNSNMGLIHTPCSEK 1188 >ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114330032|ref|YP_740713.1| hypothetical chloroplast RF2 [Nandina domestica] gi|122165906|sp|Q09FP8.1|YCF2_NANDO RecName: Full=Protein Ycf2 gi|114054515|gb|ABI49908.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114054534|gb|ABI49927.1| hypothetical chloroplast RF2 [Nandina domestica] Length = 2299 Score = 60.8 bits (146), Expect = 8e-07 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD EGKNLH YLNFNSN+GLIH CS K Sbjct: 1154 CQPLSDMNPSDSEGKNLHQYLNFNSNMGLIHIPCSEK 1190 >gb|AFU96444.1| Ycf2, partial (chloroplast) [Caloncoba echinata] Length = 2559 Score = 60.5 bits (145), Expect = 1e-06 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLN---FNSNIGLIHTSCSAK 696 CQL S MNPSD EGKNLH YLN FNSN+GLIHT CS K Sbjct: 1285 CQLLSDMNPSDSEGKNLHQYLNXXXFNSNMGLIHTPCSEK 1324 >ref|YP_538978.1| Ycf2 [Gossypium hirsutum] gi|91208964|ref|YP_538997.1| Ycf2 [Gossypium hirsutum] gi|372291071|ref|YP_005087831.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291087|ref|YP_005087848.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|372291814|ref|YP_005088958.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|372291829|ref|YP_005088975.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|109896299|sp|Q2L949.1|YCF2_GOSHI RecName: Full=Protein Ycf2 gi|85687457|gb|ABC73669.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|85687478|gb|ABC73690.1| hypothetical chloroplast RF2 [Gossypium hirsutum] gi|318084439|gb|ADV38914.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084455|gb|ADV38930.1| Ycf2 (chloroplast) [Gossypium darwinii] gi|318084609|gb|ADV39082.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|318084624|gb|ADV39097.1| Ycf2 (chloroplast) [Gossypium mustelinum] gi|329317280|gb|AEB90637.1| ycf2 (chloroplast) [Gossypium hirsutum] gi|329317296|gb|AEB90653.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317364|gb|AEB90720.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317380|gb|AEB90736.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317448|gb|AEB90803.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317464|gb|AEB90819.1| Ycf2 (chloroplast) [Gossypium barbadense] gi|329317532|gb|AEB90886.1| ycf2 (chloroplast) [Gossypium barbadense] gi|329317548|gb|AEB90902.1| Ycf2 (chloroplast) [Gossypium barbadense] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1154 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1190 >ref|YP_008992938.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium sturtianum] gi|326457519|gb|ADZ74778.1| hypothetical chloroplast RF21 [Gossypium sturtianum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_008992852.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|570879979|ref|YP_008992871.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium stocksii] gi|326457431|gb|ADZ74691.1| hypothetical chloroplast RF21 [Gossypium stocksii] gi|326457454|gb|ADZ74714.1| hypothetical chloroplast RF21 [Gossypium stocksii] Length = 2296 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1154 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1190 >ref|YP_008992766.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|570759726|ref|YP_008992785.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium longicalyx] gi|326457343|gb|ADZ74604.1| hypothetical chloroplast RF21 [Gossypium longicalyx] gi|326457365|gb|ADZ74626.1| hypothetical chloroplast RF21 [Gossypium longicalyx] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_008992680.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|570759640|ref|YP_008992699.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium herbaceum] gi|326457258|gb|ADZ74520.1| hypothetical chloroplast RF21 [Gossypium herbaceum] gi|326457279|gb|ADZ74541.1| hypothetical chloroplast RF21 [Gossypium herbaceum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_008992593.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|570759034|ref|YP_008992613.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium bickii] gi|326457169|gb|ADZ74432.1| hypothetical chloroplast RF21 [Gossypium bickii] gi|326457193|gb|ADZ74456.1| hypothetical chloroplast RF21 [Gossypium bickii] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_006503651.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|394831032|ref|YP_006503668.1| Ycf2 (chloroplast) [Gossypium robinsonii] gi|335354708|gb|AEH43324.1| Ycf2 [Gossypium robinsonii] gi|335354724|gb|AEH43340.1| Ycf2 [Gossypium robinsonii] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_006503402.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830770|ref|YP_006503419.1| Ycf2 (chloroplast) [Gossypium somalense] gi|394830929|ref|YP_006503568.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|394830945|ref|YP_006503585.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354456|gb|AEH43075.1| Ycf2 [Gossypium somalense] gi|335354472|gb|AEH43091.1| Ycf2 [Gossypium somalense] gi|335354624|gb|AEH43241.1| Ycf2 (chloroplast) [Gossypium areysianum] gi|335354640|gb|AEH43257.1| Ycf2 (chloroplast) [Gossypium areysianum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_006503319.1| Ycf2 (chloroplast) [Gossypium incanum] gi|394830683|ref|YP_006503336.1| Ycf2 (chloroplast) [Gossypium incanum] gi|335354372|gb|AEH42992.1| Ycf2 [Gossypium incanum] gi|335354388|gb|AEH43008.1| Ycf2 [Gossypium incanum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_006503485.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|394830856|ref|YP_006503502.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|570758921|ref|YP_008992507.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|570758946|ref|YP_008992526.1| hypothetical chloroplast RF21 (chloroplast) [Gossypium anomalum] gi|326457080|gb|ADZ74344.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|326457105|gb|ADZ74369.1| hypothetical chloroplast RF21 [Gossypium anomalum] gi|335354540|gb|AEH43158.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] gi|335354556|gb|AEH43174.1| Ycf2 (chloroplast) [Gossypium capitis-viridis] Length = 2302 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >gb|AEB90554.1| Ycf2 (chloroplast) [Gossypium hirsutum] gi|329317212|gb|AEB90570.1| Ycf2 (chloroplast) [Gossypium hirsutum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1154 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1190 >ref|YP_006303533.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|386800894|ref|YP_006303550.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|329317112|gb|AEB90471.1| Ycf2 (chloroplast) [Gossypium gossypioides] gi|329317128|gb|AEB90487.1| Ycf2 (chloroplast) [Gossypium gossypioides] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192 >ref|YP_005088322.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|372291443|ref|YP_005088339.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|318084777|gb|ADV39248.1| Ycf2 (chloroplast) [Gossypium tomentosum] gi|318084794|gb|ADV39265.1| Ycf2 (chloroplast) [Gossypium tomentosum] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1154 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1190 >ref|YP_005087735.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|372290984|ref|YP_005087752.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|318084688|gb|ADV39160.1| Ycf2 (chloroplast) [Gossypium raimondii] gi|318084702|gb|ADV39174.1| Ycf2 (chloroplast) [Gossypium raimondii] Length = 2298 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 806 CQLPSYMNPSDLEGKNLHMYLNFNSNIGLIHTSCSAK 696 CQ S MNPSD E KNLH YLNFNSN+GLIHT CS K Sbjct: 1156 CQPLSDMNPSDSEEKNLHQYLNFNSNMGLIHTPCSEK 1192