BLASTX nr result
ID: Sinomenium22_contig00020575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020575 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281069.1| PREDICTED: glucose-1-phosphate adenylyltrans... 59 9e-07 >ref|XP_002281069.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic [Vitis vinifera] Length = 520 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/67 (50%), Positives = 44/67 (65%) Frame = +3 Query: 147 MAVSTDGRLSFSAAGNFRGSTGLAVRSGKFNLKFGDGESMGNQLKMSGFNAMRRLPSSKR 326 MAVSTD R+S SAAG G+TGLA RS + +KF +GE MG +LKM+ R +K Sbjct: 1 MAVSTDARISLSAAGQLHGTTGLAGRSLR-QVKFCNGEMMGKKLKMTQLGMFR----NKS 55 Query: 327 SGRYVCM 347 G++VCM Sbjct: 56 VGKHVCM 62