BLASTX nr result
ID: Sinomenium22_contig00020229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00020229 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517313.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002517313.1| conserved hypothetical protein [Ricinus communis] gi|223543576|gb|EEF45106.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +3 Query: 3 FGWEYRKPERISPSCPYKPGASKEKTVDSKGSHPLEETVGADEVPREVGKRDDKQE 170 FGWEYRKPER P+CPYKP AS+E++ G+ ET V V +RD KQ+ Sbjct: 34 FGWEYRKPERAPPACPYKPSASREESAKQAGAE--GETGARVPVSGSVEERDGKQD 87