BLASTX nr result
ID: Sinomenium22_contig00019695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00019695 (3325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32742.1| hypothetical protein MIMGU_mgv1a005397mg [Mimulus... 65 3e-07 >gb|EYU32742.1| hypothetical protein MIMGU_mgv1a005397mg [Mimulus guttatus] Length = 485 Score = 64.7 bits (156), Expect = 3e-07 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +2 Query: 3173 KMEN*HDSFLIID---SVDDGFPIVTLHFENSLSLMVYPHEYLFHYHVLQAL 3319 K++ HD + D SVDDGFP VTLHFENSL+LMVYPHEYLF + L + Sbjct: 339 KLQTLHDQYTCFDYSGSVDDGFPPVTLHFENSLTLMVYPHEYLFPFEDLMCI 390