BLASTX nr result
ID: Sinomenium22_contig00019678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00019678 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 63 5e-08 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula ... 60 3e-07 ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|... 39 4e-06 gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris... 55 8e-06 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 285 IRMPPTIPINHYGGPRNQQNRTTRPILLFHAN 190 I MPPTIPINHYG RNQQNRT RPILLFHAN Sbjct: 1 ILMPPTIPINHYGDSRNQQNRTARPILLFHAN 32 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 297 SDN*IRMPPTIPINHYGGPRNQQNRTTRPILLFHAN 190 S N I M PT+PINHYG RNQQNRT PILLFHAN Sbjct: 11 SSNRILMSPTVPINHYGNSRNQQNRTAHPILLFHAN 46 >ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|AES97349.1| Tar1p [Medicago truncatula] Length = 553 Score = 38.9 bits (89), Expect(2) = 4e-06 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 285 IRMPPTIPINHYGGPRNQQNR 223 IRMPPT+P+NHY P Q NR Sbjct: 454 IRMPPTVPVNHYSDPEGQHNR 474 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 25/71 (35%), Positives = 31/71 (43%) Frame = -3 Query: 215 VLFYYSMLMYSSKGLL*TL*FFQSKSPGSPTRPVKGMRLPRRKGPAESVRSIRRTDQPDP 36 +L+ Y MLMY + L Q + G P RRTD+P+P Sbjct: 477 ILWCYPMLMYPERRLA----LSQERIAGRRDEPTGAHH--------------RRTDRPNP 518 Query: 35 RFNYELFNGNN 3 R NYELFN NN Sbjct: 519 RSNYELFNCNN 529 >gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -2 Query: 279 MPPTIPINHYGGPRNQQNRTTRPILLFHANVFEQRPALNTLIFS 148 MPPT+P+NH G RNQQNR RPILLFHAN P+ N +F+ Sbjct: 1 MPPTVPVNHCGVSRNQQNRNARPILLFHAN---PDPSFNYELFN 41