BLASTX nr result
ID: Sinomenium22_contig00018882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00018882 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF62340.1| glutamine synthetase [Avicennia marina] 86 4e-15 ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citr... 86 5e-15 gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans... 86 7e-15 emb|CAB72423.1| glutamine synthetase [Brassica napus] 85 9e-15 ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutr... 85 9e-15 ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prun... 85 9e-15 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chlo... 85 9e-15 emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassi... 85 9e-15 gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa s... 85 9e-15 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis] 85 1e-14 gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegu... 85 1e-14 gb|AAX35343.1| glutamine synthetase [Cucumis melo] 85 1e-14 ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinu... 84 2e-14 ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme... 84 2e-14 ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme... 84 2e-14 emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera] 84 2e-14 ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme... 84 2e-14 ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme... 84 2e-14 dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites austr... 84 2e-14 dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites austr... 84 2e-14 >dbj|BAF62340.1| glutamine synthetase [Avicennia marina] Length = 432 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 377 VGRDTEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 417 >ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina] gi|568872159|ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 [Citrus sinensis] gi|568872161|ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 [Citrus sinensis] gi|557521651|gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina] Length = 432 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGRETEK+GKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 377 VGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 417 >gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra] Length = 432 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGRETEK+GKGYLEDRRPASNMDPY+VTSLLAETTILWEPT Sbjct: 377 VGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT 417 >emb|CAB72423.1| glutamine synthetase [Brassica napus] Length = 428 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 373 VGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 413 >ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|567143676|ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|567143680|ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092591|gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092592|gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] gi|557092593|gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum] Length = 426 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 371 VGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 411 >ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica] gi|462419320|gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica] Length = 432 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGRETEK+GKGYLEDRRPASNMDPYVVTSLLAETT+LWEPT Sbjct: 377 VGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT 417 >sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|296223|emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus] Length = 428 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 373 VGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 413 >emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus] Length = 428 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 373 VGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 413 >gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis] Length = 428 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEKKGKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 373 VGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 413 >gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis] Length = 433 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGRETEK+GKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 378 VGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 418 >gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli] Length = 432 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGRETEK+GKGYLEDRRPASNMDPY+VTSLLAETT+LWEPT Sbjct: 377 VGRETEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPT 417 >gb|AAX35343.1| glutamine synthetase [Cucumis melo] Length = 432 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK+GKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 377 VGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 417 >ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis] gi|223543889|gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis] Length = 432 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK GKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 377 VGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 417 >ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis vinifera] gi|296086690|emb|CBI32325.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK GKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 378 VGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 418 >ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis vinifera] gi|297736964|emb|CBI26165.3| unnamed protein product [Vitis vinifera] Length = 432 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK+GKGYLEDRRPASNMDPY+VTSLLAETTILWEPT Sbjct: 377 VGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPT 417 >emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera] Length = 433 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK GKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 378 VGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 418 >ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, partial [Cucumis sativus] Length = 249 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK+GKGYLEDRRPASNMDPYVVTSLLAETT+LWEPT Sbjct: 194 VGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT 234 >ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like [Cucumis sativus] Length = 432 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TEK+GKGYLEDRRPASNMDPYVVTSLLAETT+LWEPT Sbjct: 377 VGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPT 417 >dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis] gi|44885918|dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis] Length = 429 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TE KGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 374 VGRDTEAKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 414 >dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis] Length = 429 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +3 Query: 3 VGRETEKKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 125 VGR+TE KGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT Sbjct: 374 VGRDTEAKGKGYLEDRRPASNMDPYVVTSLLAETTILWEPT 414