BLASTX nr result
ID: Sinomenium22_contig00018522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00018522 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524704.1| PREDICTED: probable xyloglucan endotransgluc... 55 8e-06 gb|ABB72442.1| xyloglucan endotransglucosylase [Gerbera hybrid c... 55 8e-06 >ref|XP_003524704.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 6-like [Glycine max] Length = 291 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 97 MAKPATFLQDFHVTWSEAHIKQLENGTAIQL 5 + +PATFLQDFHVTWS++HIKQL+ G AIQL Sbjct: 26 LGRPATFLQDFHVTWSDSHIKQLDQGRAIQL 56 >gb|ABB72442.1| xyloglucan endotransglucosylase [Gerbera hybrid cultivar] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 94 AKPATFLQDFHVTWSEAHIKQLENGTAIQLL 2 AKPATFLQDF +TWS++HIKQL+ G AIQLL Sbjct: 33 AKPATFLQDFRITWSDSHIKQLDGGRAIQLL 63