BLASTX nr result
ID: Sinomenium22_contig00017416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00017416 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854230.1| hypothetical protein AMTR_s00048p00225630 [A... 74 2e-11 gb|EXC35169.1| hypothetical protein L484_022722 [Morus notabilis] 73 5e-11 ref|XP_002268140.1| PREDICTED: uncharacterized protein LOC100244... 72 6e-11 ref|XP_004148981.1| PREDICTED: uncharacterized protein LOC101206... 70 4e-10 ref|XP_004512363.1| PREDICTED: uncharacterized protein LOC101502... 69 5e-10 ref|XP_003612571.1| Zinc finger protein [Medicago truncatula] gi... 69 5e-10 ref|XP_007209783.1| hypothetical protein PRUPE_ppa013644mg [Prun... 68 1e-09 ref|XP_006432829.1| hypothetical protein CICLE_v10003066mg [Citr... 68 2e-09 ref|XP_002519888.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 gb|ABK23810.1| unknown [Picea sitchensis] 66 4e-09 ref|XP_006368272.1| hypothetical protein POPTR_0001s01165g [Popu... 66 6e-09 ref|XP_007158114.1| hypothetical protein PHAVU_002G125300g [Phas... 65 7e-09 ref|XP_007040928.1| Uncharacterized protein TCM_016739 [Theobrom... 65 1e-08 gb|ACU15227.1| unknown [Glycine max] 63 4e-08 ref|XP_004953052.1| PREDICTED: uncharacterized protein LOC101771... 62 6e-08 ref|XP_002967959.1| hypothetical protein SELMODRAFT_408914 [Sela... 62 8e-08 ref|XP_002452424.1| hypothetical protein SORBIDRAFT_04g025570 [S... 61 1e-07 ref|XP_004300403.1| PREDICTED: zinc finger protein 706-like [Fra... 61 2e-07 ref|XP_004246058.1| PREDICTED: zinc finger protein 706-like [Sol... 60 4e-07 ref|XP_003575328.1| PREDICTED: uncharacterized protein LOC100844... 59 5e-07 >ref|XP_006854230.1| hypothetical protein AMTR_s00048p00225630 [Amborella trichopoda] gi|548857899|gb|ERN15697.1| hypothetical protein AMTR_s00048p00225630 [Amborella trichopoda] Length = 68 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDSG 119 A ALK+SCPICKV LAN NQL DHYASKHPKEKPPSDSG Sbjct: 30 AVALKSSCPICKVQLANQNQLVDHYASKHPKEKPPSDSG 68 >gb|EXC35169.1| hypothetical protein L484_022722 [Morus notabilis] Length = 67 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALKTSCPICKV LANP QL DHYASKHPKEKPPS++ Sbjct: 30 AVALKTSCPICKVQLANPKQLGDHYASKHPKEKPPSEA 67 >ref|XP_002268140.1| PREDICTED: uncharacterized protein LOC100244227 [Vitis vinifera] gi|296085504|emb|CBI29236.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDSG 119 A ALK +CPICKV LAN NQL DHY+SKHPKEKPPSDSG Sbjct: 30 AVALKITCPICKVQLANQNQLGDHYSSKHPKEKPPSDSG 68 >ref|XP_004148981.1| PREDICTED: uncharacterized protein LOC101206237 [Cucumis sativus] gi|449515019|ref|XP_004164547.1| PREDICTED: uncharacterized protein LOC101231828 [Cucumis sativus] Length = 68 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDSG 119 A ALK CPICKV LAN NQL DHY SKHPKEKPPS+SG Sbjct: 30 AVALKVICPICKVQLANQNQLGDHYGSKHPKEKPPSESG 68 >ref|XP_004512363.1| PREDICTED: uncharacterized protein LOC101502200 [Cicer arietinum] Length = 68 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK +CPICKV LANPNQL DHYASKHPKEKPP++S Sbjct: 30 AVGLKLTCPICKVQLANPNQLADHYASKHPKEKPPAES 67 >ref|XP_003612571.1| Zinc finger protein [Medicago truncatula] gi|355513906|gb|AES95529.1| Zinc finger protein [Medicago truncatula] Length = 68 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 AALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK +CPICKV LANPNQL DHYASKHPKEKPP++S Sbjct: 31 AGLKITCPICKVQLANPNQLADHYASKHPKEKPPAES 67 >ref|XP_007209783.1| hypothetical protein PRUPE_ppa013644mg [Prunus persica] gi|462405518|gb|EMJ10982.1| hypothetical protein PRUPE_ppa013644mg [Prunus persica] Length = 111 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALK +CPICKV LANP QL DHYASKHP+EKPP++S Sbjct: 73 AVALKITCPICKVQLANPKQLGDHYASKHPREKPPAES 110 >ref|XP_006432829.1| hypothetical protein CICLE_v10003066mg [Citrus clementina] gi|557534951|gb|ESR46069.1| hypothetical protein CICLE_v10003066mg [Citrus clementina] Length = 68 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALK SCPICK LAN NQ+ DHYASKHPKEKPP++S Sbjct: 30 AVALKVSCPICKAQLANQNQIGDHYASKHPKEKPPTES 67 >ref|XP_002519888.1| conserved hypothetical protein [Ricinus communis] gi|223540934|gb|EEF42492.1| conserved hypothetical protein [Ricinus communis] Length = 68 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALK CPICK LAN NQL DHYASKHPKEKPPS+S Sbjct: 30 AVALKVICPICKTQLANHNQLGDHYASKHPKEKPPSES 67 >gb|ABK23810.1| unknown [Picea sitchensis] Length = 68 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 AAALK +CPICKV LAN NQ+ DHY+SKHPKEKPP S Sbjct: 30 AAALKFTCPICKVQLANQNQIGDHYSSKHPKEKPPPQS 67 >ref|XP_006368272.1| hypothetical protein POPTR_0001s01165g [Populus trichocarpa] gi|550346176|gb|ERP64841.1| hypothetical protein POPTR_0001s01165g [Populus trichocarpa] Length = 68 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALK +C ICKV LAN NQL DHYASKHPKEKPP++S Sbjct: 30 AVALKVTCSICKVQLANSNQLGDHYASKHPKEKPPAES 67 >ref|XP_007158114.1| hypothetical protein PHAVU_002G125300g [Phaseolus vulgaris] gi|561031529|gb|ESW30108.1| hypothetical protein PHAVU_002G125300g [Phaseolus vulgaris] Length = 68 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICKV LAN NQL DHYASKHPKEKPP++S Sbjct: 30 AVGLKVICPICKVQLANQNQLADHYASKHPKEKPPAES 67 >ref|XP_007040928.1| Uncharacterized protein TCM_016739 [Theobroma cacao] gi|508778173|gb|EOY25429.1| Uncharacterized protein TCM_016739 [Theobroma cacao] Length = 68 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A ALK SCPICKV LAN QL DHY SKHPKE+PP++S Sbjct: 30 AVALKASCPICKVQLANAKQLGDHYTSKHPKERPPAES 67 >gb|ACU15227.1| unknown [Glycine max] Length = 68 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICK LAN NQL DHYASKHPKEKPP++S Sbjct: 30 AVGLKVICPICKAHLANQNQLVDHYASKHPKEKPPAES 67 >ref|XP_004953052.1| PREDICTED: uncharacterized protein LOC101771525 [Setaria italica] Length = 69 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICKV LAN QL DHY SKHPKEKPPS S Sbjct: 30 AVGLKVVCPICKVQLANEKQLTDHYGSKHPKEKPPSTS 67 >ref|XP_002967959.1| hypothetical protein SELMODRAFT_408914 [Selaginella moellendorffii] gi|300164697|gb|EFJ31306.1| hypothetical protein SELMODRAFT_408914 [Selaginella moellendorffii] Length = 209 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 AAALK +CPICK LAN NQL DH+ASKHPKE PP D+ Sbjct: 167 AAALKINCPICKSQLANYNQLRDHFASKHPKEIPPPDT 204 >ref|XP_002452424.1| hypothetical protein SORBIDRAFT_04g025570 [Sorghum bicolor] gi|241932255|gb|EES05400.1| hypothetical protein SORBIDRAFT_04g025570 [Sorghum bicolor] Length = 70 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICKV LAN QL DHY SKHPKEKPPS S Sbjct: 30 AVGLKVVCPICKVQLANEKQLIDHYGSKHPKEKPPSTS 67 >ref|XP_004300403.1| PREDICTED: zinc finger protein 706-like [Fragaria vesca subsp. vesca] Length = 68 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSD 113 A ALK SCPICK LAN QL DHYASKHP+E+PP++ Sbjct: 30 AVALKISCPICKAQLANAKQLADHYASKHPREQPPAE 66 >ref|XP_004246058.1| PREDICTED: zinc finger protein 706-like [Solanum lycopersicum] Length = 68 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICK LAN NQL DHY SKHPKEK PS+S Sbjct: 30 AVGLKVICPICKAQLANQNQLVDHYGSKHPKEKAPSNS 67 >ref|XP_003575328.1| PREDICTED: uncharacterized protein LOC100844699 [Brachypodium distachyon] Length = 70 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +3 Query: 3 AAALKTSCPICKVLLANPNQLNDHYASKHPKEKPPSDS 116 A LK CPICKV LAN QL DHY SKHP+EKPP S Sbjct: 30 AVGLKIICPICKVQLANEKQLTDHYGSKHPREKPPGPS 67