BLASTX nr result
ID: Sinomenium22_contig00016949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016949 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512262.1| Pre-rRNA-processing protein TSR2, putative [... 51 6e-07 >ref|XP_002512262.1| Pre-rRNA-processing protein TSR2, putative [Ricinus communis] gi|223548223|gb|EEF49714.1| Pre-rRNA-processing protein TSR2, putative [Ricinus communis] Length = 213 Score = 50.8 bits (120), Expect(2) = 6e-07 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 19 LESSLHKSMVFTSNTDIEDGSIEEVAEAEALMILYEECLHRNYKSMEKLRK 171 LE+ L + M+ + NT IEDGS+EEVAE LMI++EECL NY ++E+LR+ Sbjct: 81 LENILDEGMI-SLNTMIEDGSVEEVAEK--LMIMHEECLEGNYHTIEQLRQ 128 Score = 28.1 bits (61), Expect(2) = 6e-07 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 212 SEDGDKTLAKEASVMVADEPKQRLESKLKDMSMTRQKPR-GSVRNEDVWSFVATQSDWG 385 S+D D ++ S M+ D PK +SK ++ M +P + ED W+ ++++ + G Sbjct: 154 SDDDDNSMGDNRSNMMMDAPK--FQSKPNEVDMQVNEPSCQEAQVEDEWTVISSKKNRG 210