BLASTX nr result
ID: Sinomenium22_contig00016715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016715 (958 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Viti... 60 1e-06 emb|CBI35293.3| unnamed protein product [Vitis vinifera] 60 1e-06 >ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Vitis vinifera] Length = 441 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 237 CCTKCLVXXXXXXXXXXXXKSAPRIRPVLPRHQRYEKWHIYRDMELQ 97 CCT+CL SAPR+RPVLP HQRY+KW+IYRDMELQ Sbjct: 392 CCTQCL--KDLRGCCCLDCTSAPRLRPVLPGHQRYKKWYIYRDMELQ 436 >emb|CBI35293.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -2 Query: 237 CCTKCLVXXXXXXXXXXXXKSAPRIRPVLPRHQRYEKWHIYRDMELQ 97 CCT+CL SAPR+RPVLP HQRY+KW+IYRDMELQ Sbjct: 291 CCTQCL--KDLRGCCCLDCTSAPRLRPVLPGHQRYKKWYIYRDMELQ 335